DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr68a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:364 Identity:66/364 - (18%)
Similarity:138/364 - (37%) Gaps:95/364 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRL--YMIN--- 118
            :|.|||    :..|:..|.::.|:|...:|  |.:|.|    ..:..:.:.|:.::  |::.   
  Fly    71 SAQGDT----EEINRTIETLLCIISYTMVV--LSSVQN----ASRHFRTLHDIAKIDEYLLANGF 125

  Fly   119 ---------PQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNL 174
                     ..|.:....|:|..||  :.|..           |.|    :|...::.:..|..|
  Fly   126 RETYSCRNLTILVTSAAGGVLAVAF--YYIHY-----------RSG----IGAKRQIILLLIYFL 173

  Fly   175 AISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAF-MTRCCYLSD--QLEDIGEVQS 236
            .:....|:.|.:|.          :::..::|:.||..:...| :..|.::.:  :|.::.||..
  Fly   174 QLLYSTLLALYLRT----------LMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLC 228

  Fly   237 QLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSI-----IVCILI 296
            :.:.:...::.|.|:..|..:...:.::...||::::....|    .||:||.:     :.||.:
  Fly   229 KFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAG----SLSSKTEVADTIGLSCIWV 289

  Fly   297 TLFYLDALVNCNN--------------MLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQL 347
            ....:..:|.|:.              :.|:....|.|..|          :|..|.:|.     
  Fly   290 LAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNL----------IDKFLTKSI----- 339

  Fly   348 QLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
               :..|:....|.|.|...:...:.::|....:.||||
  Fly   340 ---KQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 66/364 (18%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 66/364 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.