DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr63a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:453 Identity:78/453 - (17%)
Similarity:145/453 - (32%) Gaps:167/453 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDWVVLLLKAVHIYCYLIGLSNFEFD---------------CRTGRVFKSR-------------R 38
            ::|.:.::..:.|..:....:.||.:               |..|.|..:|             .
  Fly    80 INWFLRIIGVLPIVRHGPARAKFEMNSASFIYSVVFFVLLACYVGYVANNRIHIVRSLSGPFEEA 144

  Fly    39 CTIYAFMANI--FILITIIYN--------FTAHGDTNLLFQSAN------KLHE---YVIIIMSG 84
            ...|.|:.||  .::|.|::.        |....|..:|:...:      ||.:   |:.|::..
  Fly   145 VIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQISGHSLPLKLRQKAVYIAIVLPI 209

  Fly    85 LKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMI-RWGILLKAFISFAIELLQVTLSV 148
            |.:::.:||.:.       |..|..:.:..|.|...|.:|: .|..|:...:|....||..... 
  Fly   210 LSVLSVVITHVT-------MSDLNINQVVPYCILDNLTAMLGAWWFLICEAMSITAHLLAERFQ- 266

  Fly   149 DALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLR 213
            .||...|.|.|:                           |.||::..:|..:..::         
  Fly   267 KALKHIGPAAMV---------------------------ADYRVLWLRLSKLTRDT--------- 295

  Fly   214 NGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQ------------GLMAY---SEYYLS 263
            ..|......::|..|..|  :...:..::.||.|.||::            ||:.|   ..:|.|
  Fly   296 GNALCYTFVFMSLYLFFI--ITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAHYAS 358

  Fly   264 I-VGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYL--DALVNCNNMLRVLDHHKDFLGLLE 325
            : |.|::..           ||         :::.|.::  ||....|..||..:          
  Fly   359 VNVRTNFQK-----------KL---------LMVELNWMNSDAQTEINMFLRATE---------- 393

  Fly   326 ERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDM 388
                                     .||..||..|.|.:.|.....:..:::...:.|:||.:
  Fly   394 -------------------------MNPSTINCGGFFDVNRTLFKGLLTTMVTYLVVLLQFQI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 77/446 (17%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 78/453 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.