DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr59f

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:282 Identity:51/282 - (18%)
Similarity:108/282 - (38%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FEFDC-RTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHEYVI-IIMSGLK 86
            :..|| ||.|..:     :..|:..||..:.|.:|...|  ..::::|...::.||: .|:|.:.
  Fly   142 YTIDCNRTKRFIR-----LQLFLVGIFACLAIFFNIWTH--KFVVYRSILSINSYVMPNIISSIS 199

  Fly    87 ------IVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSM--------------------I 125
                  ::.|:     .|.||.....|.:::..|:  :|::..:                    .
  Fly   200 FAQYYLLLQGI-----AWRQRRLTEGLERELTHLH--SPRISEVQKIRMHHANLIDFTKAVNRTF 257

  Fly   126 RWGILL---KAFISFAIELLQVTLSVDALDRQGTAEMMGLLV-------KLCVSFIMNLAI-SQH 179
            ::.|||   ..|::|.:.|..|...::........:.:.:|:       |:|.....|.:| ::|
  Fly   258 QYSILLLFVGCFLNFNLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEH 322

  Fly   180 FLVI-LLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVG 243
            ...: ||.|..|      .|..|:::.....:|:|.                  .|:..:...|.
  Fly   323 STCLTLLSRVSY------ARKDIQDTITHFIIQMRT------------------NVRQHVVCGVI 363

  Fly   244 QLDEVFGMQGLMAYSEYYLSIV 265
            .||..|....|:|.:::::.::
  Fly   364 NLDLKFLTTLLVASADFFIFLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 51/282 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 51/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.