DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr57a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:442 Identity:88/442 - (19%)
Similarity:151/442 - (34%) Gaps:142/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDW---VVLLLKAVHIYCYLIGLSNF---EFDCRTGRVFKSRR-----CTIYAFMANIFILITI- 54
            :.|   :..:..|:..:|.|.|..:.   |.|.|. |:.|:..     ..:...|:.:...:|: 
  Fly    41 ISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRE-RLAKADNLVLSISALELLMSTLVFGVTVI 104

  Fly    55 -----------IYNFTAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLV 108
                       ||...|..|..|:......|: |..::...:.:: |::|.:.........:|:.
  Fly   105 SLQVFARRHLGIYQRLAALDARLMSDFGANLN-YRKMLRKNIAVL-GIVTTIYLMAINSAAVQVA 167

  Fly   109 KDVIRLYMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMG----LLVKLCVS 169
            .....|:::.....:::..|.....::...:                 |||:|    ||.:|...
  Fly   168 SGHRALFLLFALCYTIVTGGPHFTGYVHMTL-----------------AEMLGIRFRLLQQLLQP 215

  Fly   170 FIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEV 234
            ..:|....|..:..|.|| |...|..:|..:|:|..|:..|.|           .:....|:...
  Fly   216 EFLNWRFPQLHVQELRIR-QVVSMIQELHYLIQEINRVYALSL-----------WAAMAHDLAMS 268

  Fly   235 QSQL-----QSM-VGQLDE-----VFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKT 288
            .|:|     ||: :||.:|     .:.|.|       ||::|    |...:||            
  Fly   269 TSELYILFGQSVGIGQQNEEENGSCYRMLG-------YLALV----MIPPLYK------------ 310

  Fly   289 SIIVCILITLFYLDALV----NCNNMLRVLDH---HKDFLGLLEE---------RTVFASSLDIR 337
                 :||..||.|..:    .|..::..||.   .|..|..|.|         :..|.|.||:.
  Fly   311 -----LLIAPFYCDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAKIQFTSGLDVV 370

  Fly   338 LEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVN-SIFLIQFDM 388
            |..                .|:|:|           .|::|| .:.||||.|
  Fly   371 LSR----------------KVIGLF-----------TSILVNYLLILIQFAM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 87/432 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 88/442 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.