DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr43a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:443 Identity:82/443 - (18%)
Similarity:141/443 - (31%) Gaps:145/443 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLLKAVHIYCYLIGLSN-FEFDCRTGRV---------FKSRRCTIYAFMANIFILITIIYNF- 58
            ||::.....:||.|..|:: .|.:.|..::         |:..|.......|...:.|:|:... 
  Fly    90 VVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGLD 154

  Fly    59 ------------TAHGDTNLLFQSANKLHEYV-----IIIMSGLKI-----VAGL---ITVLNRW 98
                        .|..||.|      .:|.|:     ..|::||::     ..||   ...|||.
  Fly   155 VGTWMRIAQDMNIAQSDTEL------NVHWYIPFYSLYFILTGLQVNIANTAYGLGRRFGRLNRM 213

  Fly    99 LQ-------------RGQMMQLVKDVIRLYMIN-PQLKSMIRWGILLKAFISFAIELLQVTLSVD 149
            |.             :.|.:..||:|    .:| |.:.|.:...:         .:|...||..:
  Fly   214 LSSSFLAENNATSAIKPQKVSTVKNV----SVNRPAMPSALHASL---------TKLNGETLPSE 265

  Fly   150 ALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRN 214
            |...:..|.          |.|:|:                            |..:|.:...:|
  Fly   266 AAGDKAAAR----------SLILNV----------------------------ELLKLGYFPAKN 292

  Fly   215 GAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGP 279
            ...:.:.  |:|..|.:|:       .|..|...||:..|.......|.:|.|:|..:       
  Fly   293 KGLLLKS--LADSHESLGK-------CVHLLSNSFGIAVLFILVSCLLHLVATAYFLF------- 341

  Fly   280 HNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVL----DHHKDFLGLLEERTVFASSLDIR--- 337
              |:|.:|..      ....::..|..|.:.||:|    ..|   |...|.|.......:|.   
  Fly   342 --LELLSKRD------NGYLWVQMLWICFHFLRLLMVVEPCH---LAARESRKTIQIVCEIERKV 395

  Fly   338 ----LEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
                |.|:.:....||.......:..|:..:.|....:..:::....:.||||
  Fly   396 HEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 80/439 (18%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 82/443 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.