DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr32a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:362 Identity:64/362 - (17%)
Similarity:127/362 - (35%) Gaps:114/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEM 159
            :|:|::  .::.::...:.:::......||:|          ...|:||:...|........::.
  Fly   128 VNQWIE--LLLCILTYTLTVFVCAHNTTSMLR----------IMNEILQLDEEVRRQFGANLSQN 180

  Fly   160 MGLLVKLCVSFIMNLAISQHFLVIL--------------LIRAQYRIMN-----------AKLRM 199
            .|.|||    |::.:...|.::::|              ::.|.|.|.|           |.||:
  Fly   181 FGFLVK----FLVGITACQAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRI 241

  Fly   200 VIEESRRLSFL-QLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLD--------EVFGMQGLM 255
            |.   .|..|: ||.||       |...|.....|..::.:...|.::        |.|....|.
  Fly   242 VY---IRFHFINQLLNG-------YTYGQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLF 296

  Fly   256 AYSEY------------YLSIVGTSYMSYSIYKY--GPHNL--KLSAKTSII----------VCI 294
            .|..:            ..:::..|::.||.|..  ..:||  :::.|..:.          :|:
  Fly   297 IYRMHNKLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCL 361

  Fly   295 LITLFYL----------DALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQL 349
            .::|..|          :|......:.||....|::..::::   |.:. .|:.|..|       
  Fly   362 HVSLLALLSRSCGLTTTEANATSQILARVYAKSKEYQNIIDK---FLTK-SIKQEVQF------- 415

  Fly   350 ARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
                   ...|.|.|...:...:.::|....:.||||
  Fly   416 -------TAYGFFAIDNSTLFKIFSAVTTYLVILIQF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 64/362 (18%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 64/362 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.