DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr23a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:420 Identity:74/420 - (17%)
Similarity:139/420 - (33%) Gaps:146/420 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILIT-IIYNFTAHG---DT 64
            |...::.|..|.|.|        ||....:.     |.:..:::.||::| .:..|....   |.
  Fly    52 WTQSVIYAQTIDCTL--------DCSLRHIL-----TFFQTVSHAFIVVTSFLDGFRIKQDQLDE 103

  Fly    65 NLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDV------IRLYMINPQLKS 123
            .:.|:.::....:.::.|        |:..|      |....:..:.      ||:|    .||:
  Fly   104 PIAFEDSDPWLAFTVLAM--------LVPTL------GVEYLVCSNAPEYAFRIRIY----HLKT 150

  Fly   124 MIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRA 188
            :..:..|....|||.:|:::|.:                                          
  Fly   151 LPSFLALQVQIISFILEVMKVNI------------------------------------------ 173

  Fly   189 QYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCY--------LSDQ----LEDIGEVQSQLQSM 241
              |:...||:::| .:|.||            |.:        .|||    ::|:....:.|..:
  Fly   174 --RVRQTKLQLLI-LARELS------------CRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYL 223

  Fly   242 VGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYL----- 301
            ..:::..||...|.....::...|..||..:...:..|..         |..||:.|.::     
  Fly   224 FVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWR---------IYAILLNLGFIFNVAL 279

  Fly   302 ---DALVNCN---NMLRVLDHHKDFLGLLEERTV--FASSL--DIRLEESFESLQLQLARNPLKI 356
               .|..:|.   |:.|.       :|.|..:.|  ..|.|  |:..|.|.::|..:..     :
  Fly   280 QMAAACWHCQQSYNLGRQ-------IGCLISKLVKPQGSKLYNDLVSEFSLQTLHQRFV-----V 332

  Fly   357 NVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
            .....|.:.....::|.|:|:...:.||||
  Fly   333 TAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 73/415 (18%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 54/302 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.