DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr8a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:388 Identity:85/388 - (21%)
Similarity:154/388 - (39%) Gaps:65/388 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GRVFKSRRCTIYAFMA-NIFILITI-------IYN---FTAHGDTNLLFQSANKLHEYVIIIMSG 84
            |...::||    ..|| ::|:||::       :::   |...||   :|..||...:||...:..
  Fly    30 GNPARTRR----RLMAWSLFLLISLSALVLACLFSGEEFLYRGD---MFGCANDALKYVFAELGV 87

  Fly    85 LKIVAGLIT----VLNRWLQR----GQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFISFAIEL 141
            |.|....::    :.|.|...    ||...||.       :..:.:...|:.|.|     :|:..
  Fly    88 LAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS-------LRSEFQQFCRYLIFL-----YAMMA 140

  Fly   142 LQVTLSVDALDRQGTAEMMGL-------LVKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLRM 199
            .:|.:.:.....|...:.|.|       ||.|  :::.||   |..|.:.|:|.|...:..::.:
  Fly   141 AEVAIHLGLWQFQALTQHMLLFWSTYEPLVWL--TYLRNL---QFVLHLELLREQLTGLEREMGL 200

  Fly   200 VIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSI 264
            :.|.||   |......:|.....:|..:|.....:.|.:..|:......|....|.......:.|
  Fly   201 LAEYSR---FASETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRI 262

  Fly   265 -VGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITL-FYLDALVNCNNMLRVLDHHKDFLGLLEER 327
             |...:|.||||     |..::....:||..|:.: .::.|..:|..::..:.|.   |..:...
  Fly   263 AVDCYFMYYSIY-----NNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQ---LHNIVTD 319

  Fly   328 TVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDMEF 390
            :...|..|:.|:  .::..|||...|::|:.:|:..:.......|..||....|:.|||..:|
  Fly   320 SGCCSCPDLSLQ--IQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQFIPKF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 84/386 (22%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 82/382 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.