DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr22d

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster


Alignment Length:419 Identity:86/419 - (20%)
Similarity:172/419 - (41%) Gaps:82/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFT---AHGDTN 65
            :|.::||::....:|:|:..|:::.:..|:.:|....::..:.:..:||.::....   .||...
  Fly    12 FVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLILFGVVISSSLLILMVKQSAEDREHGIML 76

  Fly    66 LLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGIL 130
            .:||....|  |.|..:.|:..|..:.||..|.|.|.:.::.:.:                 |::
  Fly    77 DVFQRNALL--YQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYN-----------------GLM 122

  Fly   131 L---KAFISFAIELLQVTLSVDALD----RQGTAEMMGLLVKLCVSF--------IMN-LAISQH 179
            |   |.|.|.|:|       ..|.|    ::|...::|||....|.|        ::| |.:|..
  Fly   123 LLEAKYFCSNAVE-------CPAFDGYVIQKGVVIVVGLLAPWMVHFGMPDSKLPVLNVLVVSMV 180

  Fly   180 FLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYL-------SDQLEDIGEVQSQ 237
            .|..||:...|.     |.:||    ...|:.|.|...::..|.|       |.::..:.::.::
  Fly   181 KLGTLLLALHYH-----LGVVI----IYRFVWLINRELLSLVCSLRGNHKGSSSRVRFLLKLYNK 236

  Fly   238 LQSMVGQLDEVFGMQGLMAYSEYY-LSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITL--- 298
            |.::..:|.:.:..|.::..:.:. .:|:...||  .:|:     :.||..:..::.|:..|   
  Fly   237 LVNLYSKLADCYDCQTVLMMAIFLAANIIVCFYM--IVYR-----ISLSKMSFFVMLIMFPLAIA 294

  Fly   299 -----FYLDALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINV 358
                 |:|...| |:.:.:........|.|..:    ..::|..||.|.....|..:....|...
  Fly   295 NNFMDFWLSMKV-CDLLQKTGRQTSMILKLFND----IENMDKDLEISISDFALYCSHRRFKFLH 354

  Fly   359 MGMFPITRGSTAAMCASVIVNSIFLIQFD 387
            .|:|.:.|.....|..:.::..::|:|||
  Fly   355 CGLFHVNREMGFKMFVASVLYLLYLVQFD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 85/414 (21%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 85/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.