DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr10a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:430 Identity:85/430 - (19%)
Similarity:155/430 - (36%) Gaps:104/430 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITII-------YNFTAHGDT-----N 65
            |:|..:.|  ....|....|..|.....:.....::|.::.|:       |:|....||     .
  Fly    23 HVYALIYG--QVVIDYVPQRALKRGVKVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQ 85

  Fly    66 LLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGIL 130
            |||        ||....:.:|....::|             .|.:.:....|| |..:|.|..:.
  Fly    86 LLF--------YVSFTNTAIKYATVIVT-------------YVANTVHFEAIN-QRCTMQRTHLE 128

  Fly   131 LK---------------AFISFAIELLQVTLSVDALDRQ----GTAEMMGLLVKLCV-SFIM--- 172
            .:               .:..|.:..|.:.:.|..:..|    |...:..:.|...: :|::   
  Fly   129 FEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNY 193

  Fly   173 --NLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQ 235
              |:|...:|:...::: .||..|.:|..:.:|...|.    ..|..:..||.|||:||   |::
  Fly   194 TENMADYCYFINGSVLK-YYRQFNLQLGSLRDEMDGLR----PGGMLLHHCCELSDRLE---ELR 250

  Fly   236 SQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTS--------IIV 292
            .:.:.:.....|.|.|...........:::......|:::    |.|   ||.|        ::.
  Fly   251 RRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLF----HML---AKQSLEEVSYPVVVG 308

  Fly   293 CILITLFYLD----ALVNCNNMLRVLDHHK---DFLGLLEERTVFASSLDIRLEESFESLQLQLA 350
            .:..|.||:|    ||:|        :|.|   :.:.|...|......:|.||....|.|.|:|.
  Fly   309 SVYATGFYIDTYIVALIN--------EHIKLELEAVALTMRRFAEPREMDERLTREIEHLSLELL 365

  Fly   351 --RNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDM 388
              :.|:   :.|:..:.|.....:..:.....|.|:|||:
  Fly   366 NYQPPM---LCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 85/430 (20%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 84/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.