DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr22a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster


Alignment Length:433 Identity:77/433 - (17%)
Similarity:165/433 - (38%) Gaps:107/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KAVHIYC---------------YLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILI-TIIYNF 58
            |.:|..|               :::||..|.||.|..|:.:|:....|..:.|:.:|: :::.:.
  Fly     5 KRIHRICKGLARFTIRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTLLVLSMLPST 69

  Fly    59 TAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRL--------- 114
            ..|....:.....|.|.:.|..::..:.::..|:|.|..:.:..::::::.:::.|         
  Fly    70 DDHNSVKVEVFQRNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLM 134

  Fly   115 ---------YMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSF 170
                     |:|...|..::..|..|..:.......:.|..:|                  |:..
  Fly   135 LSECHTFNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAV------------------CIYI 181

  Fly   171 IM--NLAISQHF-LVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIG 232
            :.  .|.:..|| |.::.|.....|:|.:|   ::.:.|     ||.|..:.     .|:::.:.
  Fly   182 VQLEVLMVVMHFHLAVIYIYRYLWIINGQL---LDMASR-----LRRGDSVD-----PDRIQLLL 233

  Fly   233 EVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMS--YSIYKYGPHNLKLSAKTSIIVC-I 294
            .:.|:|..:..:|..::.:|             .|.:|:  :|:.....|.|        ::| |
  Fly   234 WLYSRLLDLNHRLTAIYDIQ-------------VTLFMATLFSVNIIVGHVL--------VICWI 277

  Fly   295 LITLFYLDALVNCNNMLRVLDHHKDFLGL----LEERTVFASSLDIRLEESFESLQLQLAR---- 351
            .||.|.|..:........:::....:.|:    |.|.|...:|:.::|....|::..:..|    
  Fly   278 NITRFSLLVIFLLFPQALIINFWDLWQGIAFCDLAESTGKKTSMILKLFNDMENMDQETERRVTE 342

  Fly   352 -------NPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFD 387
                   ..||:..:|:..|.......|..:.|:..:||:|||
  Fly   343 FTLFCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVFLVQFD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 77/433 (18%)
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 74/419 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.