DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr22c

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:431 Identity:95/431 - (22%)
Similarity:163/431 - (37%) Gaps:112/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLF 68
            |::  |||.....:.:|:..:.||.|.|::.:||....|..:.|.|:|:.::    ..|...|..
  Fly    14 WII--LKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMV----CSGGQKLGI 72

  Fly    69 QSANKLHEYVIIIMSGLKIVAGLITV--------LNRW----LQRGQMMQLVKDVIRLYMIN--- 118
            ..|...:.    ::.......|::.|        ||.|    :|......||.:..:...:|   
  Fly    73 PEAFARNS----VLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETK 133

  Fly   119 -PQLKSMI--RW----GILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAI 176
             |:..|.:  :|    |:|| :::|.|..|.....||:.           :|:...|.|..|..|
  Fly   134 CPKFNSFVIQKWLSVIGLLL-SYLSIAYGLPGNNFSVEM-----------VLINSLVQFSFNCNI 186

  Fly   177 SQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLS-DQLEDIGEVQSQLQS 240
            ..:::.:|||   ||                 :|.|.||..:.....|. |...|...::..| |
  Fly   187 MHYYIGVLLI---YR-----------------YLWLINGQLLEMVTNLKLDCSVDSSRIRKYL-S 230

  Fly   241 MVGQLDEVFGMQGLMAYSEYYLSIVGTSYMS---YSIYKYGPHNLKLSAKTSIIVCILITLFYLD 302
            :..:|.|:.|.  ::|..||::::|.|:.::   .:||.:  ..|.:|...:.|..::..||   
  Fly   231 LYRRLLELKGY--MVATYEYHMTLVLTTGLASNFLAIYSW--IVLDISMNINFIYLLIFPLF--- 288

  Fly   303 ALVNCNNMLRVLDHHKDFLGLLEERTVFASSL---------------------DIRLEESFESLQ 346
            .|||..|:.               .::.||.|                     ||.||.|.....
  Fly   289 LLVNVWNLW---------------LSIAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFA 338

  Fly   347 LQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFD 387
            |.........:|.|:|.|.......|..:..:..|::||||
  Fly   339 LLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 94/426 (22%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 94/426 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.