DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr22e

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:423 Identity:94/423 - (22%)
Similarity:171/423 - (40%) Gaps:89/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDT---- 64
            |..|.||......:::|:..|.:|..|..:.:|:....|.|:.|...::.::.|.| ..:|    
  Fly    13 WTGLTLKGALYGSWILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFILLVVTNDT-ESETPLRM 76

  Fly    65 -----NLLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQM---MQLVKDVIRLYMINPQL 121
                 |.|.:..|.:|:     :..|.:|:  |.:|..:.:.|.:   :..::|:...|..|..|
  Fly    77 EVFHRNALAEQINGIHD-----IQSLSMVS--IMLLRSFWKSGDIERTLNELEDLQHRYFRNYSL 134

  Fly   122 KSMIRWG--ILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHF-LVI 183
            :..|.:.  :|.|.| |..:||:.:.:....:....:|:....|..||:..:..|..:.|| |.:
  Fly   135 EECISFDRFVLYKGF-SVVLELVSMLVLELGMSPNYSAQFFIGLGSLCLMLLAVLLGASHFHLAV 198

  Fly   184 LLIRAQYRIMNAKLRMVIE--------ESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQS 240
            :.:.....|:|.:|..::.        ||.|:..|           .||..:|.|:|:       
  Fly   199 VFVYRYVWIVNRELLKLVNKMAIGETVESERMDLL-----------LYLYHRLLDLGQ------- 245

  Fly   241 MVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDALV 305
               :|..::..|.:|....:.::.|...|. :.||       .:|...|:...||:   ::.|||
  Fly   246 ---RLASIYDYQMVMVMVSFLIANVLGIYF-FIIY-------SISLNKSLDFKILV---FVQALV 296

  Fly   306 NCNNMLRVLDHHKDF-----LGLLEERTVFASS-----------LDIRLEESFESLQLQLARNPL 354
              .|||       ||     :..|.|||...:|           :|.:||.|.....|..:...|
  Fly   297 --INML-------DFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRL 352

  Fly   355 KINVMGMFPITRGSTAAMCASVIVNSIFLIQFD 387
            :.:..|:|.:.......|..:..:..:||||||
  Fly   353 RFHHCGLFYVNYEMGFRMAITSFLYLLFLIQFD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 92/418 (22%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 92/418 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.