DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr28b

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:426 Identity:82/426 - (19%)
Similarity:156/426 - (36%) Gaps:75/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANK 73
            |:.|....|:.||::|...|.|....|:.:.||:.::..|..:...::.::.     .::.:...
  Fly    45 LRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGYINGIMHIAMFVFAYSL-----TIYNNCES 104

  Fly    74 LHEYVI---IIMSG--LKIVAGLITV-------------LNRWLQRGQMMQ----------LVKD 110
            :..|..   |...|  ::||:|.|.|             |.|.||:...|.          :...
  Fly   105 VASYFFRSRITYFGDLMQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYSK 169

  Fly   111 VIRL-YMINPQLKSMIRWGILLKA---FISFAIEL-----LQVTLSVDALDRQGTAEMMGLLVKL 166
            |:|. ||:   |.||....:|...   .:.::.|:     |..|..:     |.|...:.:.:..
  Fly   170 VLRFSYMV---LISMFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLI-----QHTVIAIAIALFS 226

  Fly   167 CVSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDI 231
            |.::::.:.:.....|:..:..|:.  ...|:.|.::.|.|..|.    :|........|..|.|
  Fly   227 CFTYLVEMRLVMVNKVLKNLAHQWD--TRSLKAVNQKQRSLQCLD----SFSMYTIVTKDPAEII 285

  Fly   232 G---EVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKT----S 289
            .   |:...:.......::.|..|.|...|..:|.||..:|...... .|....:...||    :
  Fly   286 QESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETL-LGKSKRESKFKTVEFVT 349

  Fly   290 IIVCILITLFYLDALVN----CNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLA 350
            ...|.:|  .||.|:::    .|..::..:.....:..|..:|..|     .::|..:...:||.
  Fly   350 FFSCQMI--LYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSA-----EVKEKLQQFSMQLM 407

  Fly   351 RNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
            ...:.....|:|.|.|.....:..::....|.|:||
  Fly   408 HLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 82/426 (19%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 80/424 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.