DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr22b

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:418 Identity:87/418 - (20%)
Similarity:170/418 - (40%) Gaps:89/418 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKAVHIYCYLIGLSNFEFDC--RTGRVFKSRRCTIYAFMANIFILITII---YNFTAHGDTNLL 67
            :||......:|:|:..|..|.  |..::.:||..|:|..:.|.|::.|:|   :.:..|   .|.
  Fly    16 MLKTTLYGSWLLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAFEYRKH---KLE 77

  Fly    68 FQSANKLHEYVIIIMSGLKIVAGLIT-VLNRWLQRGQMMQLVKDVIRL----------------- 114
            ....|.:.|.:.:::..:.:::.||. .:|.|..| ::.::..:::.|                 
  Fly    78 AFKRNPVLEMINVVIGIINVLSALIVHFMNFWGSR-KVGEICNELLILEYQDFEGLNGRNCPNFN 141

  Fly   115 -YMINPQLKSMIRWGILLKAF-ISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAIS 177
             ::|.   |.:...|.||..| ::||:..|:..:.:             :|:...:.|.:||.|.
  Fly   142 CFVIQ---KCLTILGQLLSFFTLNFALPGLEFHICL-------------VLLSCLMEFSLNLNIM 190

  Fly   178 QHFLVILLIRAQYRIMNAKLRMVIEE---------SRRLSFLQLRNGAFMTRCCYLSDQLEDIGE 233
            .:.:.:|||.....::|.:|:.::.:         ||...||.|     ..|...|:.:|....|
  Fly   191 HYHVGVLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSL-----YKRLLELNRKLVIAYE 250

  Fly   234 VQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYG-PHNLKLSAKTSIIVCILIT 297
            .|..| .::.||      .|.:... |:|.:.|.|..:|||:... |::|.::          |.
  Fly   251 YQMTL-FIIAQL------SGNIVVI-YFLIVYGLSMRTYSIFLVAFPNSLLIN----------IW 297

  Fly   298 LFYLDALVNCNNMLRVLDHHKDFLGL---LEERTVFASSLDIRLEESFESLQLQLARNPLKINVM 359
            .|:| .:..|:...:..|.....|.:   ||.|       |.:||.|........:....:..:.
  Fly   298 DFWL-CIAACDLTEKAGDETAIILKIFSDLEHR-------DDKLEMSVNEFAWLCSHRKFRFQLC 354

  Fly   360 GMFPITRGSTAAMCASVIVNSIFLIQFD 387
            |:|.:.......|..:..:..::|:|||
  Fly   355 GLFSMNCRMGFKMIITTFLYLVYLVQFD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 87/417 (21%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 87/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.