DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr36a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:391 Identity:180/391 - (46%)
Similarity:271/391 - (69%) Gaps:0/391 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDWVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTN 65
            |.|||.||||.::.|..:|||.|||.|.:.|||..::|..::|...|:.|.:.::...:...:.:
  Fly     1 MFDWVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLD 65

  Fly    66 LLFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGIL 130
            :.|..||:||:||||:|..|::.:|:..:||||.||.|:|:||:.|:||::..|.:|.|.||.||
  Fly    66 VYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPHVKQMSRWAIL 130

  Fly   131 LKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIMNA 195
            :|..:......||:.:|:::|||.|..|.:|:.....:|.|:|:|||||:||||.:||.|.::..
  Fly   131 VKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYYHLLKT 195

  Fly   196 KLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYSEY 260
            ::|..|.||:.||.:..|..||||:||||:|::::|.::|:||||:|.||::|||:||:|.|..|
  Fly   196 EVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGY 260

  Fly   261 YLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDFLGLLE 325
            |:..|.|:|::||:...|...|.||.:.:.:|......:|..|::|...||::.|.||:...:||
  Fly   261 YIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYYTSAILNLFVMLKLFDDHKEMERILE 325

  Fly   326 ERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDMEF 390
            |||:|.|:||:|||:||||:||||.||||||.|:.:|.|||.|:|||..|:|.|||||||:|||:
  Fly   326 ERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYDMEY 390

  Fly   391 F 391
            |
  Fly   391 F 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 172/380 (45%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 172/380 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.