DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr36c

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:393 Identity:173/393 - (44%)
Similarity:259/393 - (65%) Gaps:6/393 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VDWVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNL 66
            :|....||.||:.|...|||||||||..|||||..:..|:||...:..|....||::|  |:||:
  Fly     1 MDLESFLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWT--GNTNI 63

  Fly    67 ---LFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWG 128
               :|..||.|||||:.|::||:||.||.|::.||.||.:||.|...|:|:|:..||::.|.|||
  Fly    64 VNAIFGRANMLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVRRMSRWG 128

  Fly   129 ILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIM 193
            ||.|.......:.||:.:.:.|:....:...:||.::..:..|:|:|:.|..:::|.:|.|::::
  Fly   129 ILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHMIMLFVRTQFQLI 193

  Fly   194 NAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYS 258
            |.:||.||:|::.|.......|.|||:||.|:||:|:|..:|||||:::.|::||||:||.|.|.
  Fly   194 NTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQMEEVFGIQGAMTYG 258

  Fly   259 EYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDFLGL 323
            .||||.|||.|::|||.|:|..||.::..|.|:.......:|||.::|.:.||.|.|.:.:.|.:
  Fly   259 GYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFYYLDGMLNLSVMLHVQDDYWEMLQI 323

  Fly   324 LEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDM 388
            |.:||:|. .||:||||:||:|.|||.||||||.|:.::.:||.:|.||..::|.:||||||:|:
  Fly   324 LGKRTIFV-GLDVRLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDI 387

  Fly   389 EFF 391
            |.|
  Fly   388 EHF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 169/383 (44%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 169/383 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.