DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr59a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:410 Identity:74/410 - (18%)
Similarity:161/410 - (39%) Gaps:85/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KAVHIYCYLIGLSNFEFDCRTGRVFKSRRCT-IYAFMANIFILITIIYNFTAHGDTNLLFQSANK 73
            :|.::|...||::::|   ..|..|:..|.| ||..:.|. |.:|::.  :|...:..|..:|:.
  Fly     6 QAYNVYAVFIGMTSYE---TMGGKFRQSRITRIYCLLINA-IFLTLLP--SAFWKSAKLLSTADW 64

  Fly    74 LHEYVII---IMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFI 135
            :..|:.:   ||..:...|...|:::|..:...:|.|.:.|:.   :|   :.|:|.|..:.:.:
  Fly    65 MPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLE---VN---REMLRTGKKMNSLL 123

  Fly   136 SFAIELLQVTLSVDALDRQGTAEMMGLLV---------KLCVSFIMNLAIS-------QHFLVIL 184
            .....|...||:...|     :.::.:.:         .||...::|::::       .:|..:.
  Fly   124 RRMFFLKTFTLTYSCL-----SYILAVFIYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLW 183

  Fly   185 LIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSD------QLEDIGEVQSQLQSMVG 243
            .|...|..:|.:|..::                   .|...|      :|..:..:...|.....
  Fly   184 HIARGYDFVNQQLNEIV-------------------ACQSMDLERKSKELRGLWALHRNLSYTAR 229

  Fly   244 QLDEVFGMQGLMAYSEYYL-----SIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDA 303
            ::::.:|.|.|....:|::     :.:||   .||.....|...|:..  |:|..:....|:|: 
  Fly   230 RINKHYGPQMLAMRFDYFIFSIINACIGT---IYSTTDQEPSLEKIFG--SLIYWVRSFDFFLN- 288

  Fly   304 LVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGS 368
                       |:..|.:...:.:..|.:. :..:.....|..:..:...|.:.|.|::.:.:..
  Fly   289 -----------DYICDLVSEYQMQPKFFAP-ESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRK 341

  Fly   369 TAAMCASVIVNSIFLIQFDM 388
            ...|..|::|:|..|.||.:
  Fly   342 WLQMVGSIVVHSSMLFQFHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 74/410 (18%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 74/409 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.