DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr92a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:436 Identity:75/436 - (17%)
Similarity:168/436 - (38%) Gaps:124/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKAVHIYCYLIGLSNFEFDCR-----------------TGRVFKSRRCTIYAFMANIFILITII 55
            :|:.:..|...||:..|....|                 |.|:....| ..:.::|:|.|     
  Fly    17 ILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTR-FFWVYIASISI----- 75

  Fly    56 YNFTAHGDTNLLFQSANKLHEYVIIIMSGLKIVAGL---ITVLNRWLQRG-QMMQLVKDVIRLYM 116
                   .||.:.|           ::.|:::|..:   ..:|...:.|| :::.|:...:||:.
  Fly    76 -------KTNRVLQ-----------VLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFR 122

  Fly   117 INPQLKSMIR-----WG------ILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSF 170
               |:..:.:     :|      ::|...||||.|...:..::    |:|.:... |:...|..:
  Fly   123 ---QVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTI----RKGFSWRF-LIDWWCDFY 179

  Fly   171 IM---NLAISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIG 232
            ::   |:.|..:.:..|.:...|    ::|...:..:.|:...:|..          |...:.|.
  Fly   180 LVSATNIFIHINSIGYLSLGVLY----SELNKYVYTNLRIQLQKLNT----------SGSKQKIR 230

  Fly   233 EVQSQLQSMVGQLDEVFGMQGL------------MAYSEYYLSIVGTS-----YMSYSIY--KYG 278
            .||::|:..:....|::....:            :.|....::::|.:     |::..|:  ..|
  Fly   231 RVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIFWILLG 295

  Fly   279 PHNLKLSAKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFE 343
            .|.|.|         .|:|: .::..||     :.|:....| |.:.:.:.|.::||        
  Fly   296 KHVLDL---------FLVTV-SVEGAVN-----QFLNIGMQF-GNVGDLSKFQTTLD-------- 336

  Fly   344 SLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDME 389
            :|.|.|.....:::::|:|.:|:.......::::....|:.|:.|:
  Fly   337 TLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 75/435 (17%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 74/433 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.