DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr93b

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:429 Identity:94/429 - (21%)
Similarity:169/429 - (39%) Gaps:105/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRR------CTIYAFMANIFILITIIYNFTA----H 61
            :||::..:|....|:..|..:.:..::....|      |.:...:|:.|    ..|::.|    :
  Fly    22 ILLRSCFLYGTFFGVITFRIERKDSQLVAINRRGYLWICLVIRLLASCF----YGYSYDAWSGQY 82

  Fly    62 GDTNLL----FQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVK--------DVIRL 114
            .|..|.    |:....|...|||::........||.::||:||..:.||.:.        |....
  Fly    83 EDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELINLVNRFLQLFRRMQSLTNSPKNRFGDRAEF 147

  Fly   115 YMINPQLKSMIRWGILLKAFISFAIEL---LQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAI 176
            .::..::.|      ||..|::|.:.|   ..:||..|.....||    |::..||         
  Fly   148 LLMFSKVFS------LLFVFMAFRLMLSPWFLLTLVCDLYTSVGT----GMITHLC--------- 193

  Fly   177 SQHFLVILLIRAQYRIMN--------AKLRMVIEESRRLSFLQLRNGAFMTR--------CCYLS 225
               |:..|.|...||.:|        |:||.:..|:.  ||   ||....||        |.||.
  Fly   194 ---FVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENN--SF---RNNPQPTRQAISNLDKCLYLY 250

  Fly   226 DQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSY-----MSYSIYKYGPHNLKLS 285
            |::..:.....||          |.:...::.::..|::...||     ..||...:|     |.
  Fly   251 DEIHQVSRSFQQL----------FDLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWG-----LV 300

  Fly   286 AKTSIIVCILITLFYLDALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLA 350
            .|..|.| :|:|: .:.:.||.:.::|.|.....::       ..:.|...:||.....||.|  
  Fly   301 IKLLIDV-VLLTM-SVHSAVNGSRLIRRLSFENFYV-------TDSQSYHQKLELFLGRLQHQ-- 354

  Fly   351 RNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQFDME 389
              .|::..:|:|.::...|....::::...:||:|:.|:
  Fly   355 --ELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQYGMQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 93/427 (22%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 92/425 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.