DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr93c

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster


Alignment Length:345 Identity:67/345 - (19%)
Similarity:133/345 - (38%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWG--------ILLKAFISFAIELLQ 143
            ::.|:..::.:.....::::::...:||:....:|.|:.|.|        :||..||....||..
  Fly    95 LICGICIIVVQVCYEKELLRMIISFLRLFRRVRRLSSLKRIGFGGKREFFLLLFKFICLVYELYS 159

  Fly   144 VTLSVDALDRQGTAEMMGLLVKLCVSFI---MNLAISQHFLVILLIRAQYRIMNAKLRMVIEESR 205
            ....:..|     .:.:.|...||..|:   ..:.|...|:..|.:.|.|..:|:..|  ||..|
  Fly   160 EICQLWHL-----PDSLSLFATLCEIFLEIGSLMIIHIGFVGYLSVAALYSEVNSFAR--IELRR 217

  Fly   206 RLSFLQLRNGAFMTR------------CCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAYS 258
            :|..|:...|..:.|            |..:.|::|.:|....:|.    :|..:..:.|     
  Fly   218 QLRSLERPVGGPVGRKQLRIVEYRVDECISVYDEIERVGRTFHRLL----ELPVLIILLG----- 273

  Fly   259 EYYLSIVGTSYMSYSIY--------KYGPHNLKLSAKTSIIVCILITLFYLDALVNCNNMLR--- 312
                .|..|:.:||.:.        |.|...|.:.:...:   ||:||...:| |:.:.|:|   
  Fly   274 ----KIFATTILSYEVIIRPELYARKIGMWGLVVKSFADV---ILLTLAVHEA-VSSSRMMRRLS 330

  Fly   313 -----VLDH---HKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGST 369
                 :.||   |..:       .:|.|.|:.     ||          .::..:|:|.::....
  Fly   331 LENFPITDHKAWHMKW-------EMFLSRLNF-----FE----------FRVRPLGLFEVSNEVI 373

  Fly   370 AAMCASVIVNSIFLIQFDME 389
            ....:|:|....:::|:.::
  Fly   374 LLFLSSMITYFTYVVQYGIQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 67/345 (19%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 67/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.