DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr28a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:450 Identity:88/450 - (19%)
Similarity:160/450 - (35%) Gaps:131/450 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIGLSNFEFDCRTGRVFKSRRCTIYAFMANI--FILITIIYNFTA-HGD--------TNLLFQSA 71
            |:||:.|..:....:..::.:   ::|.|.|  |:...:.:..:. .||        ||:...|.
  Fly    27 LLGLAPFRLNLNPRKEVQTSK---FSFFAGIVHFLFFVLCFGISVKEGDSIIGYFFQTNITRFSD 88

  Fly    72 NKLHEYVIIIMSGLKIVAGLITVLN-RWLQRGQMMQLVKDVIRLYMINPQLKSMIRWG------- 128
            ..|....|:.||         |:.. ...:|.:::.::::.|.:..|      .:|.|       
  Fly    89 GTLRLTGILAMS---------TIFGFAMFKRQRLVSIIQNNIVVDEI------FVRLGMKLDYRR 138

  Fly   129 ILLKAF-ISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSF--IMNLAISQHFLVILLIRAQY 190
            |||.:| ||..:.|..|                   :.||||:  :::..||..|:..    ..:
  Fly   139 ILLSSFLISLGMLLFNV-------------------IYLCVSYSLLVSATISPSFVTF----TTF 180

  Fly   191 RIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQ-SQLQSMVGQLDEVFGMQGL 254
            .:.:..:.:::     ..||...:.| .:|...|::.|:||.:.. .||.::  :|..:..:...
  Fly   181 ALPHINISLMV-----FKFLCTTDLA-RSRFSMLNEILQDILDAHIEQLSAL--ELSPMHSVVNH 237

  Fly   255 MAYSEYYLSIVGTSYMSY---SIYKYGP----------HNLKLSAKTSI---------------I 291
            ..||....:::.|....|   |:.:..|          |||......:|               .
  Fly   238 RRYSHRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISF 302

  Fly   292 VCILITLFY-LDALVNCNNMLRVLDHHKDFLGLL----------------EERTVFASSL----- 334
            :.||...|| |:|::| ...|.|.:..:.|...|                ..||:..||.     
  Fly   303 LFILFDDFYILEAILN-PKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIV 366

  Fly   335 --------DIRLEESFESLQLQLARNPLKINVMGMFPITRGSTAAMCASVIVNSIFLIQF 386
                    |..|.:....|.|||:...:.....|:|.:.|.....:..:.....|.||||
  Fly   367 HKILNITDDPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 87/449 (19%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 87/449 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.