DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36b and Gr39a

DIOPT Version :9

Sequence 1:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:416 Identity:87/416 - (20%)
Similarity:169/416 - (40%) Gaps:86/416 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKAVHIYCYLIGLSNFEFDCRTGRVFKSRR---CTIYAFMANIFIL--ITIIYNFTAHGDTNLLF 68
            |.|.:..|..:|:...::: .|.:.|:.||   |.|..|....:::  |:::..:......:.|.
  Fly     8 LCAYYRLCRYLGIFCIDYN-PTKKKFRLRRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELT 71

  Fly    69 QSANKLHEYVIIIMSGLKIV--AGLITVLNRWLQRGQMMQLVKDV----------IRLYMINPQL 121
            .:.|.....|::|..|:.:|  |.||     ||| ...:::|:.:          :||.:....|
  Fly    72 TTGNHFDRLVMVIALGILVVQNAWLI-----WLQ-APHLRIVRQIEFYRRNHLANVRLLLPKRLL 130

  Fly   122 KSMIRWGILLKA-FISFAI-ELLQVTLSVDALDRQGTAEMMGLLVK-LCVSFIMNLAISQHFLVI 183
            ..:|...::..| ||...| |.|     .|| .|......:|..:: |..||.|    ..:|.::
  Fly   131 WLIIATNVVYMANFIKTCIFEWL-----TDA-SRLFVITSLGFPLRYLVTSFTM----GTYFCMV 185

  Fly   184 LLIRAQYRIMNAKLRMVIEESRRLSF-----LQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVG 243
            .::|.......:::..:|:||..|..     |:||      .|..:.|:|            |:.
  Fly   186 HIVRLVLDWNQSQINAIIDESADLKMTSPNRLRLR------VCLEMHDRL------------MLL 232

  Fly   244 QLDEVFGMQGLMAYSEYY---LSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLD-AL 304
            ..||:..:.|.:|:..:.   |.:.|..|::          :.:..|.||::.::..:.:|. ..
  Fly   233 CNDEISLVYGFIAWLSWMFASLDVTGVIYLT----------MVIQTKKSIVLKLITNVVWLSPTF 287

  Fly   305 VNC-----NNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPI 364
            :.|     :|  ||.........:|.:.....:.|| |:.|.|  |...|.:.|: :...|.|.:
  Fly   288 MTCAASFMSN--RVTIQANKTAKMLTKVPRTGTGLD-RMIEKF--LLKNLRQKPI-LTAYGFFAL 346

  Fly   365 TRGSTAAMCASVIVNSIFLIQF-DME 389
            .:.:...:..::....:.|:|| :||
  Fly   347 DKSTLFKLFTAIFTYMVILVQFKEME 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 87/416 (21%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 85/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.