DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr98d

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster


Alignment Length:357 Identity:67/357 - (18%)
Similarity:125/357 - (35%) Gaps:115/357 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KMMDLASK--VVRMYVARP-----QVRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDS---- 156
            |:|....|  ||.|:|...     ..||::|       |:..|.| |::.:..::.|.|..    
  Fly    83 KVMGNTQKVLVVAMFVWNQLNILLNFRRLAR-------IYDDIAD-LEIDLNNASSGFVGQRHWW 139

  Fly   157 --QFYLGLGLQYWMFVIL------------------NMAMMQQHMIML---------FV------ 186
              :|.|.|.:..|:.:::                  |..:.:..:|||         ||      
  Fly   140 RFRFRLALSVGLWIVLLVGLTPRFTLVALGPYLHWTNKVLTEIILIMLQLKCTEYCVFVLLIYEL 204

  Fly   187 ----RTQFQLINTEL--RQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQM 245
                |...|.|:.||  .|..|..::|.::.:...:...:...|.:::.....:...|..:.|::
  Fly   205 ILRGRHILQQISVELEGNQSRDSVQELCVALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYNEL 269

  Fly   246 EEVFGIQGAMTYGGYYLSS-----------VGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFY 299
            ..:..:..|:      :.|           ||||.|           ||:.:....|...:|...
  Fly   270 TILQIVNWAL------IKSVNPNECCQYRRVGTCLL-----------LSINIFLSCLYSEFCIQT 317

  Fly   300 Y--LDGMLNLSVMLHVQDDYWEMLQILGKRTIFVGLDVRLEEAFENLNLQLIRNPLKITVVKLYD 362
            |  :..:|:....|...:||                 :.|:......:||:....|..|...|:|
  Fly   318 YNSISRVLHQMYCLSAAEDY-----------------LILKMGLREYSLQMEHLKLIFTCGGLFD 365

  Fly   363 VTRSNTMAMFGNLIT----HSIFLIQYDIEHF 390
            :    .:..||.::.    :.|.|:|:.|:.|
  Fly   366 I----NLKFFGGMVVTLFGYIIILVQFKIQFF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 66/354 (19%)
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 66/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.