DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr68a

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:255 Identity:45/255 - (17%)
Similarity:97/255 - (38%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MVLSAMGSVDS-QFY-------LGLGLQYWMFVILNMAMMQQHMIMLFVRTQFQLINTE---LRQ 199
            :|.||.|.|.: .||       :|...|..:.:|..:.::...::.|::||....:...   |.|
  Fly   137 LVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQ 201

  Fly   200 VIDEAKDLLLSPRHQGVFMTKCCSLAD---QIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYY 261
            .:|             .|..:.|...:   ::.|:..:..:.:.|...:..|.|:.....:|..:
  Fly   202 KLD-------------TFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSF 253

  Fly   262 LSSVGTCYLAYSILKHG-YENLSMTLSTVILAYSWCFFYYLDGMLNLSVMLHVQDDYWEMLQILG 325
            .:.....|||::.|..| ..:.:....|:.|:..|.....:..::..|....:..:.....|||.
  Fly   254 YTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILA 318

  Fly   326 KRTIFVGLDVRLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQY 385
            :   ..|...:.:...:....:.|:..|:.|....:.:..|....:|..:.|:.:.|||:
  Fly   319 R---IYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 45/255 (18%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 45/255 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.