DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr59f

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:415 Identity:77/415 - (18%)
Similarity:145/415 - (34%) Gaps:131/415 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYYYGLFIGLSNFEFDW-NTGRVFTKKWSTLYAIALDSCIFALYIY----------HWTGN--TN 62
            :.:||||:..|.:||.. .|.||...:    |..|::|.|:.::|:          :|...  ||
  Fly    72 ILWYGLFVLGSYWEFVLVTTQRVSLDR----YLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTN 132

  Fly    63 IVNAIFGRAN-----------MLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYV 116
            ||.:...||.           .|..::|.|...|.|...::|                   ..:|
  Fly   133 IVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWT-------------------HKFV 178

  Fly   117 ARPQVRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHM 181
            ....:..      :..::..:|...:..|           |:||         ::..:|..|:  
  Fly   179 VYRSILS------INSYVMPNIISSISFA-----------QYYL---------LLQGIAWRQR-- 215

  Fly   182 IMLFVRTQFQLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQME 246
                          .|.:.::.....|.|||            ..:::.|....:.|......:.
  Fly   216 --------------RLTEGLERELTHLHSPR------------ISEVQKIRMHHANLIDFTKAVN 254

  Fly   247 EVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSW-CFFYYLDGML-NLSV 309
            ..|.....:.:.|.:|:.....:|.|    .|.||.||...|     .| |...:|...: .:..
  Fly   255 RTFQYSILLLFVGCFLNFNLVLFLVY----QGIENPSMADFT-----KWVCMLLWLAMHVGKVCS 310

  Fly   310 MLH----VQDDYWEMLQILGKRTIFVGLDVRLEEAFENLNLQL---IRNPLKITVVKLYDVTRSN 367
            :||    :|:::...|.:| .|..:...|:  ::...:..:|:   :|..:...|:.| |:....
  Fly   311 ILHFNQSIQNEHSTCLTLL-SRVSYARKDI--QDTITHFIIQMRTNVRQHVVCGVINL-DLKFLT 371

  Fly   368 TMAMFGNLITHS---IFLIQYDIEH 389
            |:     |:..:   |||:|||:.:
  Fly   372 TL-----LVASADFFIFLLQYDVTY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 77/413 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 75/410 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.