DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr21a

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:206 Identity:41/206 - (19%)
Similarity:73/206 - (35%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FMTKCCSLADQIENIARIQSQLQTI---------MNQMEEVFGIQGAMTYGGYYLSSVGTCYLA- 271
            |.|...:|:|.::...|.:...|.:         ::.|.:..|...:..||.|.|....|..:| 
  Fly   258 FGTASRALSDALQTTIRGEKPAQKLTEYRHLWVDLSHMMQQLGRAYSNMYGMYCLVIFFTTIIAT 322

  Fly   272 ----YSILKHG--YENLSMTLSTVILAYSWCFFY----------------YLDGMLNL---SVML 311
                ..|:.||  |:.:.:   .||:.|.....|                :...:||:   :|..
  Fly   323 YGSISEIIDHGATYKEVGL---FVIVFYCMGLLYIICNEAHYASRKVGLDFQTKLLNINLTAVDA 384

  Fly   312 HVQDDYWEMLQILGKRTIFVGLDVRLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLI 376
            ..|.:...:|..:.|....:.||     .:.|:|.:||             .|..:.||      
  Fly   385 ATQKEVEMLLVAINKNPPIMNLD-----GYANINRELI-------------TTNISFMA------ 425

  Fly   377 THSIFLIQYDI 387
            |:.:.|:|:.|
  Fly   426 TYLVVLLQFKI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 41/206 (20%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 41/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.