DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr10a

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:385 Identity:74/385 - (19%)
Similarity:155/385 - (40%) Gaps:57/385 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVFTKKWSTLYAIALDSCIFALYIYHWTGNTNIVNAIFGRANMLHEYVVAILTGLRIVTGLFTLI 95
            :|....:..|:::.|...:...:.||:...|:.::    |...|..||....|.::..|.:.|.:
  Fly    47 KVLLIAYGHLFSMLLIVVLPGYFCYHFRTLTDTLD----RRLQLLFYVSFTNTAIKYATVIVTYV 107

  Fly    96 LRWY------QRCKMMDLASKVVRMYV------ARPQVRRMSRWGILTKFIFGSITDGLQMAMVL 148
            ....      |||.|.       |.::      |..:.:|...:.:..||...::...:|:..:.
  Fly   108 ANTVHFEAINQRCTMQ-------RTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVCGIF 165

  Fly   149 SAMGSVD----SQFYLGLGLQYWMFVILNMAMMQQ---HMIMLFVRTQFQLINTELRQVIDEAKD 206
            :..|.|.    ||..:...:  :.||:.|......   :.|...|...::..|.:|..:.||...
  Fly   166 AQYGEVGKGSVSQVRVHFAI--YAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLGSLRDEMDG 228

  Fly   207 LLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQMEEV--FGIQGAMTYGGYYLSSVGTCY 269
            |    |..|:.:..||.|:|::|.:.|...::..:..:...:  |.:.|.|.  ...::::...|
  Fly   229 L----RPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLML--STLINNLTNFY 287

  Fly   270 LAYSIL-KHGYENLSMTLSTVILAYSWCFFYYLD----GMLNLSVMLHVQDDYWEMLQILGKRTI 329
            ..:.:| |...|.:|.   .|::...:...:|:|    .::|..:.|.::.....|.:....|. 
  Fly   288 TLFHMLAKQSLEEVSY---PVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFAEPRE- 348

  Fly   330 FVGLDVRLEEAFENLNLQLI--RNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDI 387
               :|.||....|:|:|:|:  :.|:   :..|..:.|.....:.....::.|.|:|:|:
  Fly   349 ---MDERLTREIEHLSLELLNYQPPM---LCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 74/385 (19%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 73/383 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.