DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr36a

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:391 Identity:179/391 - (45%)
Similarity:270/391 - (69%) Gaps:4/391 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLESFLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIYHWTGNTNIVNA 66
            |....||..:||||..|||.|||.||..|||...:...|:|||::..|..:.:...:...|: :.
  Fly     3 DWVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNL-DV 66

  Fly    67 IFGRANMLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVRRMSRWGILT 131
            .|||||.||:||:.::..||:.:|:..::.||.||.::|.|...|:|:::.:|.|::||||.||.
  Fly    67 YFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPHVKQMSRWAILV 131

  Fly   132 KFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHMIMLFVRTQFQLINTE 196
            ||..|.:::.||||:.:.::..:....::|:...:||..|:|||:.|.::::||||..:.|:.||
  Fly   132 KFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYYHLLKTE 196

  Fly   197 LRQVIDEAKDLL-LSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGY 260
            :||.|.|::.|. :.|| :..||||||.|||:|:|||::|:|||:|:.|:.:||||||.|.||||
  Fly   197 VRQAIHESQMLSEIYPR-RAAFMTKCCYLADRIDNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGY 260

  Fly   261 YLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFYYLDGMLNLSVMLHVQDDYWEMLQILG 325
            |:.||.|.|:.||:..:|.|.|.:::....|.:||..|||...:|||.|||.:.||:.||.:||.
  Fly   261 YIFSVATTYITYSLAINGIEELHLSVRAAALVFSWFLFYYTSAILNLFVMLKLFDDHKEMERILE 325

  Fly   326 KRTIFV-GLDVRLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDIEH 389
            :||:|. .||||||::||::.||||||||||.|:.::.:|||::.||.|::||:||||||||:|:
  Fly   326 ERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYDMEY 390

  Fly   390 F 390
            |
  Fly   391 F 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 175/382 (46%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 175/382 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.