DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr59a

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:434 Identity:82/434 - (18%)
Similarity:149/434 - (34%) Gaps:130/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGAVY-YYGLFIGLSNFEFDWNTGRVFTKKWST-LYAIALDSCIFALYIYHWTGNTNIVNAIFGR 70
            :|..| .|.:|||::::|   ..|..|.:...| :|.:.:::....|          :.:|.:..
  Fly     4 IGQAYNVYAVFIGMTSYE---TMGGKFRQSRITRIYCLLINAIFLTL----------LPSAFWKS 55

  Fly    71 ANMLH------------EYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVRR 123
            |.:|.            .|::..:....|.   :|||.|.|:...:|||...|:.  |.|..:|.
  Fly    56 AKLLSTADWMPSYMRVTPYIMCTINYAAIA---YTLISRCYRDAMLMDLQRIVLE--VNREMLRT 115

  Fly   124 MSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHMIMLFVRT 188
            ..:...|.:.:|...|    ..:..|.:..:.:.|......|.|. .:.|..::...:.:|||.|
  Fly   116 GKKMNSLLRRMFFLKT----FTLTYSCLSYILAVFIYQWKAQNWS-NLCNGLLVNISLTILFVNT 175

  Fly   189 QF------------QLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTI 241
            .|            ..:|.:|.:::                       |.|..::.|...:|:  
  Fly   176 FFYFTSLWHIARGYDFVNQQLNEIV-----------------------ACQSMDLERKSKELR-- 215

  Fly   242 MNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKH-GYENLSMTLSTVILAYSWCFFYYLDGML 305
                             |.:.......|.|..|.|| |.:.|:|.           |.|::..::
  Fly   216 -----------------GLWALHRNLSYTARRINKHYGPQMLAMR-----------FDYFIFSII 252

  Fly   306 N--LSVMLHVQDDYWEMLQILGKRTIFV-GLDVRL--------------------EEAFEN-LNL 346
            |  :..:....|....:.:|.|....:| ..|..|                    |.:..| |:.
  Fly   253 NACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKFFAPESSMSNELSS 317

  Fly   347 QLI---RNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDI 387
            .||   ...|.:.|..||.|.:...:.|.|:::.||..|.|:.:
  Fly   318 YLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQFHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 82/434 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 81/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.