DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr22f

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:419 Identity:72/419 - (17%)
Similarity:144/419 - (34%) Gaps:99/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLGAVYYYGLFIGLSNFEFDWNTGRVFTKKWSTLYAIALDSCIFALYI-YHWTGNTNIVNAIFG 69
            |:|....|....:||..|.||....::...:|..||...|.|....|.: .|...........|.
  Fly    17 FMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYNAFE 81

  Fly    70 RANMLHEYVVAILTGLRIVTGLFT----LILRWYQRCKMMDLASKVVRM---------------- 114
            |..:|.:..:...     ||..||    |::..::...:..:|::::.:                
  Fly    82 RNPLLEKIYMQFQ-----VTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNF 141

  Fly   115 --YVARPQVRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMM 177
              :|.:..|..:.::.|...|.........::..:|..:.||        |||        :.:|
  Fly   142 NCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSV--------GLQ--------LIIM 190

  Fly   178 QQHMIMLFVRTQFQLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIM 242
            ..|..::.|.....|:|    :.::::..|..|..|         :||...:.:.:: |:|....
  Fly   191 HFHTEIILVYRYVWLVN----ETLEDSHHLSSSRIH---------ALASLYDRLLKL-SELVVAC 241

  Fly   243 NQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYS-------WCFFYY 300
            |.::.:..:.       .||  :|.....:.::..|   :||....:.|..|       |.|:  
  Fly   242 NDLQLILMLI-------IYL--IGNTVQIFFLIVLG---VSMNKRYIYLVASPQLIINFWDFW-- 292

  Fly   301 LDGMLNLSVMLHVQDDYWEMLQILGKRT-----IFVGL---DVRLEEAFENLNLQLIRNPLKITV 357
                ||:.|.        ::....|.:|     :|..|   |..||.:.............:..:
  Fly   293 ----LNIVVC--------DLAGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQL 345

  Fly   358 VKLYDVTRSNTMAMFGNLITHSIFLIQYD 386
            ..|:.:..:....|......:.::|:|:|
  Fly   346 CGLFSINHNMGFQMIITSFLYLVYLLQFD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 71/417 (17%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 71/417 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.