DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr36c and Gr98b

DIOPT Version :9

Sequence 1:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:424 Identity:83/424 - (19%)
Similarity:148/424 - (34%) Gaps:141/424 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TGRVF--TKKWSTLY------AIALDSCIFALYIYHWT---GNTN----IVNAIFGRANMLHEYV 78
            ||.||  |...:|::      .||:|..:....:..:|   ||..    .:.||....|||..| 
  Fly    45 TGYVFYATAILATVFIVSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYSIMAIANHLNMLINY- 108

  Fly    79 VAILTGLRIVTGLFTLILRWYQRCKM-MDLASKVVRMYVARPQVR-RMSR----WGILTKFIFGS 137
                   |.:.|::..|    ...:| ||.||:.......|...| ||:.    |.||   :.||
  Fly   109 -------RRLGGIYKDI----ADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMIL---MVGS 159

  Fly   138 ITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILNMAMMQQHMIML----FVRTQFQLINTELR 198
            :.     .:.::|||...|..         :.::....|:.|.:..|    ||...::|: ..||
  Fly   160 MP-----RLTMTAMGPFVSTL---------LKILTEFVMIMQQLKSLEYCVFVLIIYELV-LRLR 209

  Fly   199 QVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQSQLQTIMNQMEEVFGIQGAMTYGGYYLS 263
            :.:.:.::.......|.:....|.:|.         ::||     .:..::.::|.:  |.|:..
  Fly   210 RTLSQLQEEFQDCEQQDMLQALCVALK---------RNQL-----LLGRIWRLEGDV--GSYFTP 258

  Fly   264 SVGTCYLAYSILKHGYENLSMTLSTVILAYSWCF---FYYLDGMLNLSVMLHVQDDYWEMLQILG 325
            ::...:|        |..|     |::...:|.:   |.|              |...:..:.|.
  Fly   259 TMLLLFL--------YNGL-----TILHMVNWAYINKFLY--------------DSCCQYERFLV 296

  Fly   326 KRTIFVGL----------------------DVRLEEAFENL----------NLQLIRNPLKITVV 358
            ..|:.|.|                      .:|...|..|.          :||:....|:.|..
  Fly   297 CSTLLVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNFAMLTRGLREYSLQMEHLKLRFTCG 361

  Fly   359 KLYDVTRSNTMAMFGNLIT----HSIFLIQYDIE 388
            .|:|:    .:..||.|:.    :.|.|||:.::
  Fly   362 GLFDI----NLKYFGGLLVTIFGYIIILIQFKVQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 83/424 (20%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 83/422 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.