DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr93a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:143/391 - (36%) Gaps:103/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISR---CYRD 95
            |...::|.|....:|.||. ...:|.|.||.:.....::..|:     |.|::.:.:|   .:|:
  Fly    62 RCIVVMIYAGLWPMLTSAV-IGKRLESYADVLALAQSMSVSIL-----AVISFVIQARGENQFRE 120

  Fly    96 AM---LMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILAVF----------- 146
            .:   |...|||.|......|...|.:...|.::|    |||. .|...|:.:|           
  Fly   121 VLNRYLALYQRICLTTRLRHLFPTKFVVFFLLKLF----FTLC-GCFHEIIPLFENSHFDDISQM 180

  Fly   147 ------IYQWKAQNWSNLC------NGLLVNISLTILFVNTFFYFTSLWHIARGYDFVNQQLNEI 199
                  ||.|    ...||      .|.||:   .||:.          |:|..   :...|..:
  Fly   181 VGTGFGIYMW----LGTLCVLDACFLGFLVS---GILYE----------HMANN---IIAMLKRM 225

  Fly   200 VACQSMDLERK--------------SKELRGLWALHRNLSYTARRINKHYGPQMLAMRFDYFIFS 250
            ...:|.| ||.              :.||....|::..|.:......:....|:|.    |...:
  Fly   226 EPIESQD-ERYRMTKYRRMQLLCDFADELDECAAIYSELYHVTNSFRRILQWQILF----YIYLN 285

  Fly   251 IINACI----GTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQ----PKFFAP 307
            .||.|:    ..::...|.    |.:|.|:   |.:|....|..:..:.::|.::    ||....
  Fly   286 FINICLMLYQYILHFLNDD----EVVFVSI---VMAFVKLANLVLLMMCADYTVRQSEVPKKLPL 343

  Fly   308 ESSMSN-------ELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQFHLVMRG 365
            :...|:       .:.::|....:.||::.|.|.:.:|....|.::.:|:.:..:|.||.:.  |
  Fly   344 DIVCSDMDERWDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGIT--G 406

  Fly   366 G 366
            |
  Fly   407 G 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 79/386 (20%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 79/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.