DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr43a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:371 Identity:68/371 - (18%)
Similarity:123/371 - (33%) Gaps:124/371 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YNVYAVFIGM------TSYETMGGKFRQSRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMP 66
            |::|.:..|:      |:| .:|.:|  .|:.|            :|.|:|.......|.     
  Fly   183 YSLYFILTGLQVNIANTAY-GLGRRF--GRLNR------------MLSSSFLAENNATSA----- 227

  Fly    67 SYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNREML---RTGKK--MNSLLRRM 126
                :.|..:.|:...::        .|.||...|...:.::|.|.|   ..|.|  ..||:..:
  Fly   228 ----IKPQKVSTVKNVSV--------NRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNV 280

  Fly   127 FFLKTFTLTYSCLSYILAV---FIYQWKAQNWSNL--CNGLLVN-ISLTILFVNTFFYFTSLWHI 185
            ..||        |.|..|.   .:.:..|.:..:|  |..||.| ..:.:||:            
  Fly   281 ELLK--------LGYFPAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFI------------ 325

  Fly   186 ARGYDFVNQQLNEIVACQSMDLERKSKELRG-LWALHRNLSYTARRINKHYGPQMLAMRFDYF-I 248
                 .|:..|:.:.....:.||..||...| ||.                  |||.:.|.:. :
  Fly   326 -----LVSCLLHLVATAYFLFLELLSKRDNGYLWV------------------QMLWICFHFLRL 367

  Fly   249 FSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKFFAPESSMSN 313
            ..::..|   ..:..:...:::                   .:|::  |.::.....|  .::..
  Fly   368 LMVVEPC---HLAARESRKTIQ-------------------IVCEI--ERKVHEPILA--EAVKK 406

  Fly   314 ELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359
            .....|:.::    |...|||.|||:........:|..:..:|.||
  Fly   407 FWQQLLVVDA----DFSACGLCRVNRTILTSFASAIATYLVILIQF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 68/371 (18%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 68/371 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.