DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr23a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:284 Identity:56/284 - (19%)
Similarity:88/284 - (30%) Gaps:138/284 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 RMFFLKT----FTLTYSCLSYILAVF-----IYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFT 180
            |::.|||    ..|....:|:||.|.     :.|.|.|        ||:                
  Fly   144 RIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQ--------LLI---------------- 184

  Fly   181 SLWHIARGY-----------DFVNQQLNEIVACQSMDLERKSKELRGLWALHRNLSYTARRINKH 234
                :||..           .|.:||.:.:     .||:|:          :.:|.|...|||.:
  Fly   185 ----LARELSCRWPQRKQKPQFSDQQAHRV-----KDLKRR----------YNDLHYLFVRINGY 230

  Fly   235 YGPQMLAMRFDYFIFSIINAC-------------------IGTIYSTTDQEPS------------ 268
            :|..:|.:...:|...:.|:.                   :|.|::...|..:            
  Fly   231 FGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVALQMAAACWHCQQSYNLG 295

  Fly   269 ---------LEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQ----------PKFFAPE----SS 310
                     |.|..||.:|             .|||||:.:|          ..||:..    ||
  Fly   296 RQIGCLISKLVKPQGSKLY-------------NDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSS 347

  Fly   311 MSNELSSYLIY--------ESSTR 326
            |...:.:||:.        .||||
  Fly   348 MFAAVVTYLVILIQFMFAERSSTR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 56/284 (20%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 52/273 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.