DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and lite-1

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:379 Identity:74/379 - (19%)
Similarity:140/379 - (36%) Gaps:86/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMR-------VTPYIMCTINYAAIAYTLISRC 92
            ::|||   :|.||         :..:.....|:..|       ..|..|.|:..|.|..:     
 Worm    79 VFCLL---LFTTL---------RKFNQVGVRPNGTRENLQEFFANPRSMITLCNALIMLS----- 126

  Fly    93 YRDAMLMDLQRIVLEVNREMLRTGK---------KMNSLLRRMFFLKTFTLTYSCL-------SY 141
               .:|..||...|...|  |:..|         :.....||.|.:.||...:|.|       :|
 Worm   127 ---GLLASLQLYTLGAKR--LKPLKILCQFSLNVRTKQAERRQFMINTFLAVFSGLLALTMAATY 186

  Fly   142 ILAVFIYQWKAQNWSNLCNGLLVNISLT--ILFVN---------TFFYFTSLWHIARGYDFVNQQ 195
            .::.:.|........||....:..:.|.  .|||:         .|:...|:  |.|.   :...
 Worm   187 AMSKWGYILYIVGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSV--IRRS---IKHL 246

  Fly   196 LNEIVACQSMDLERKSKELRGLWALHR-NLSYTARRINKHYGPQMLAMRFDYFIFSIINACIGTI 259
            :||:|..:..:.......|:   .:|. .:||  :||  ..|..::...:.:.:|.....||...
 Worm   247 INEMVPAEQDECPLPESSLQ---KIHDCQISY--QRI--FNGKAVIEEYYSFVLFYSYGVCIPIF 304

  Fly   260 YSTTDQEPSLEKI----FGSLIYWVRS-------FD---FFLNDYICDLV-SEYQMQPKFFAPES 309
            ........|.:.|    ..|::.|:.:       |.   |.:|:....|| |.::|..:.|..|.
 Worm   305 CFLMFVGMSAQSICWSEVVSIVIWIVNAILVLLLFSLPAFMINEDGDRLVASSFRMYHETFHEER 369

  Fly   310 SMS--NELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQFHL 361
            .::  ::::.:.....||:|.|..|..:.:::...|.:..:|:.:..:|::|.:
 Worm   370 DLTVLSQMTFFTFQIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLILWEFDI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 74/379 (20%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 74/379 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.