DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr22a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_722733.1 Gene:Gr22a / 117500 FlyBaseID:FBgn0045501 Length:394 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:137/393 - (34%) Gaps:86/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSY-------MRVTPYIMCTINYAAIAYT 87
            :|.| |...|..:..|.|.|..|....:.|:.:.|:.:|       :.|...:..|.::.::...
  Fly    15 ARFT-IRATLYGSWVLGLFPFTFDSRKRRLNRSKWLLAYGLVLNLTLLVLSMLPSTDDHNSVKVE 78

  Fly    88 LISRCYRDAMLMDLQRIV----------------------LEVNREMLRTGKKMNSLL------- 123
            :..   |:.::..::.:|                      :|:..|:|...|...|.|       
  Fly    79 VFQ---RNPLVKQVEELVEVISLITTLVTHLRTFSRSSELVEILNELLVLDKNHFSKLMLSECHT 140

  Fly   124 -RRMFFLKTFTLTYSCLSYILAVF-IYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLWHIA 186
             .|....|...:.....|.::..| |...|...:..:|   :..:.|.:|.|...|:...: :|.
  Fly   141 FNRYVIEKGLVIILEIGSSLVLYFGIPNSKIVVYEAVC---IYIVQLEVLMVVMHFHLAVI-YIY 201

  Fly   187 RGYDFVNQQLNEIVACQSMDLERKSKELRG-----------LWALHRNLSYTARRINKHYGPQML 240
            |....:|.||          |:..|:..||           ||...|.|... .|:...|..|:.
  Fly   202 RYLWIINGQL----------LDMASRLRRGDSVDPDRIQLLLWLYSRLLDLN-HRLTAIYDIQVT 255

  Fly   241 AMRFDYFIFSIINACIGTIYSTTDQEPSLEKIF----GSLI--YWVRSFDFFLNDYICDLV---- 295
            ......|..:||...:..|........||..||    .:||  :|    |.:.....|||.    
  Fly   256 LFMATLFSVNIIVGHVLVICWINITRFSLLVIFLLFPQALIINFW----DLWQGIAFCDLAESTG 316

  Fly   296 SEYQMQPKFFAPESSMSNE----LSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSML 356
            .:..|..|.|....:|..|    ::.:.::.|..||.:...||..:|.....:|:.:.:::...|
  Fly   317 KKTSMILKLFNDMENMDQETERRVTEFTLFCSHRRLKVCHLGLLDINYEMGFRMIITNILYVVFL 381

  Fly   357 FQF 359
            .||
  Fly   382 VQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 78/393 (20%)
Gr22aNP_722733.1 7tm_7 19..388 CDD:285581 76/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.