DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr22c

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:388 Identity:78/388 - (20%)
Similarity:154/388 - (39%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FIGMTSY--ETMGGKFRQSRITRIYCLLINAIFLTL-----------LPSAFWKSAKLLSTADWM 65
            |:|:..|  ::..|:.::||....|.|::| .||.|           :|.||.:::.|.:|    
  Fly    26 FLGVFPYRFDSRNGQLKRSRFLLFYGLILN-FFLLLKMVCSGGQKLGIPEAFARNSVLENT---- 85

  Fly    66 PSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDL--QRIVLEVNR-EMLRTGK--KMNS-LLR 124
                ..|..::...:...|.:.   ..:....:.||  :.:|||..: ..|...|  |.|| :::
  Fly    86 ----HYTTGMLAVFSCVVIHFL---NFWGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQ 143

  Fly   125 RMFFLKTFTLTYSCLSYILAVFIYQWKAQNWS---NLCNGLL---VNISLTILFVNTFFYFTSLW 183
            :...:....|:|..::|.|       ...|:|   .|.|.|:   .|.::...::.....:..||
  Fly   144 KWLSVIGLLLSYLSIAYGL-------PGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRYLW 201

  Fly   184 HIARGYDFVNQQLNEIVACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQMLAMRFDYFI 248
                   .:|.||.|:|....:|....|..:|...:|:|.|...     |.|    :...::|.:
  Fly   202 -------LINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLEL-----KGY----MVATYEYHM 250

  Fly   249 FSIINACIGT----IYSTTDQEPSLEKIFGSLIYW-----VRSFDFFLNDYICDLV----SEYQM 300
            ..::...:.:    |||....:.|:...|..|:.:     |..::.:|:....||.    ...|.
  Fly   251 TLVLTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLLVNVWNLWLSIAASDLAENAGKSTQT 315

  Fly   301 QPKFFA----PESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359
            ..|.||    .:..:...::.:.:.....:.:..||||:.:|.:...||:.:..::...:.||
  Fly   316 VLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 78/388 (20%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 78/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.