DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr36a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:400 Identity:81/400 - (20%)
Similarity:151/400 - (37%) Gaps:75/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YAVFIGMTSYETMGGKFRQSRITR-----IYCLLINAIFLTLLPSAFWKSAKL---LSTADWMPS 67
            |...||:.::|.   .:::.|:..     ::.:.||.:...:|.....|...|   ...|:.:..
  Fly    15 YGQIIGLINFEI---DWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDVYFGRANQLHQ 76

  Fly    68 YMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTF 132
            |:.:   :|.::..|:....:::|..:.|.||.|...||   |..|:  |.....:.|...|..|
  Fly    77 YVII---VMVSLRMASGISAILNRWRQRAQLMRLVECVL---RLFLK--KPHVKQMSRWAILVKF 133

  Fly   133 TLTYSCLSYILAVFIYQ-------------WKAQNW-SNLCNGLLVNISLTILFVNTFFYFTSLW 183
            ::  ..:|..|.:.|..             ..:..| |.:.|..:....|.||||..:::.  |.
  Fly   134 SV--GVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYYHL--LK 194

  Fly   184 HIARGYDFVNQQLNEIV---------ACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQM 239
            ...|.....:|.|:||.         .|...|      .:..:..|...|.....::|:.:|.|.
  Fly   195 TEVRQAIHESQMLSEIYPRRAAFMTKCCYLAD------RIDNIAKLQNQLQSIVTQLNQVFGIQG 253

  Fly   240 LAMRFDYFIFSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKF 304
            :.:...|:|||:....|  .||....  .:|::..|:......|.:||..|...:::.:.|. |.
  Fly   254 IMVYGGYYIFSVATTYI--TYSLAIN--GIEELHLSVRAAALVFSWFLFYYTSAILNLFVML-KL 313

  Fly   305 FAPESSMSNELSSYLIYES-----------STRLDLL-------VCGLYRVNKRKWLQMVGSIVV 351
            |.....|...|....::.|           |.:|.|:       |..::.:.:.....|:|||:.
  Fly   314 FDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIIT 378

  Fly   352 HSSMLFQFHL 361
            :|..|.|:.:
  Fly   379 NSIFLIQYDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 81/399 (20%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 81/399 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.