DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr77a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster


Alignment Length:464 Identity:90/464 - (19%)
Similarity:167/464 - (35%) Gaps:151/464 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRIGQAYNVYAVF--IGMTSYETMGGK-FRQSRITRIY-CLLINAIFL-TLLPSAFW------- 53
            |..:|..|::..||  :...::...|.| .|||...||: |:::  ||: ...|.|||       
  Fly    34 MSALGILYSLTRVFGLMATANWSPRGIKRVRQSLYLRIHGCVML--IFVGCFSPFAFWCIFQRMA 96

  Fly    54 --KSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNREMLRTG 116
              :..::|    .|..:.|....::|..      .||...|::.|.::.....:|:..|.     
  Fly    97 FLRQNRIL----LMIGFNRYVLLLVCAF------MTLWIHCFKQAEIIGCLNRLLKCRRR----- 146

  Fly   117 KKMNSLLRRMFFLKTFTLTYSCL--------------SYILAVFIYQWKAQ-------------N 154
                  |||:...:....:..||              ||:|::      ||             |
  Fly   147 ------LRRLMHTRKLKDSMDCLATKGHLLEVVVLLSSYLLSM------AQPIQILKDDPEVRRN 199

  Fly   155 WSNLCNGLLVNISLTILFVNTFFYFTS---LWHIARGYDFVNQQLNEIVACQSMDLER--KSKEL 214
            :...|:.:.|::...||.::...|..:   |.|:.|   ..|..|.:|:|    |.|.  :|.:.
  Fly   200 FMYACSLVFVSVCQAILQLSLGMYTMAILFLGHLVR---HSNLLLAKILA----DAEHIFESSQK 257

  Fly   215 RGLWALHRNL-----SYTA----RRINKHYGPQMLAMRFDYFIFSIINAC-------IGTIYSTT 263
            .|.|...:.|     .:.|    |.::.|:  |:|.:.     .||.:.|       :|.:    
  Fly   258 AGFWPNRQELYKGQQKWLALELWRLLHVHH--QLLKLH-----RSICSLCAVQAVCFLGFV---- 311

  Fly   264 DQEPSLEKIFGSLIYWVRSFDFFLNDY----------ICDLVSEYQ-----MQPKFFAPE----- 308
            ..|.::...|   .|:::...|.|..|          |..||..:.     :.|.:::..     
  Fly   312 PLECTIHLFF---TYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCT 373

  Fly   309 -----------------SSMSNELSSYLIYESSTR--LDLLVCGLYRVNKRKWLQMVGSIVVHSS 354
                             ..:.:.:..|.:|..:..  ..:..|||:::|......:||:|:.:..
  Fly   374 REIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLM 438

  Fly   355 MLFQFHLVM 363
            :|.||..|:
  Fly   439 ILIQFDKVL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 87/456 (19%)
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 87/456 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.