DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr92a

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:407 Identity:71/407 - (17%)
Similarity:147/407 - (36%) Gaps:120/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLIS-RCYRDAMLM 99
            |...|..||..|...   |..|.:...:|: .::.||..|:....:..:....|| :..|...::
  Fly    24 YAQFIGVIFFCLHTR---KDDKTVFIRNWL-KWLNVTHRIITFTRFFWVYIASISIKTNRVLQVL 84

  Fly   100 DLQRIVLEVN--------------------REMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILA 144
            ...|:||.:.                    .:.||..::::.|      .||.|..:.....::.
  Fly    85 HGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFRQVSDL------FKTKTPGFGGRRELIL 143

  Fly   145 VFI----------YQW----KAQNWSNL----CNGLLVNISLTILFVNTFFYFTSLWHIARG--- 188
            :.:          |.|    |..:|..|    |:..||:.:      |.|.:..|:.:::.|   
  Fly   144 ILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSAT------NIFIHINSIGYLSLGVLY 202

  Fly   189 -----YDFVN-----QQLNEIVACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQM-LAM 242
                 |.:.|     |:||  .:.....:.|....|....:|:|.:.:|:...:|.:.|.: ||:
  Fly   203 SELNKYVYTNLRIQLQKLN--TSGSKQKIRRVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLAL 265

  Fly   243 RFDYFIFSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKFFAP 307
            .:...:.::|...:           ::|....|.|:|:     .|..::.||          |..
  Fly   266 IYKVLLIALIGFNV-----------AVEFYLNSFIFWI-----LLGKHVLDL----------FLV 304

  Fly   308 ESSMSNELSSYL-----------IYESSTRLDLL------------VCGLYRVNKRKWLQMVGSI 349
            ..|:...::.:|           :.:..|.||.|            :.||:.|.:.::||.:.::
  Fly   305 TVSVEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSAL 369

  Fly   350 VVHSSMLFQFHLVMRGG 366
            :...:.:.|:.:.:..|
  Fly   370 LSGLAFIAQYRMQVGNG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 70/402 (17%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 70/401 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.