DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59a and Gr93d

DIOPT Version :9

Sequence 1:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster


Alignment Length:360 Identity:63/360 - (17%)
Similarity:131/360 - (36%) Gaps:102/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AIFLTLLPSAFWKSAKLLSTADWMPSYMRVTPYIM--CTINYAAIAYTLISR---CYRDAM---- 97
            ::.|.::|...:    ..:.|:|:.:.|.:|...:  |::..:...|..|..   |:...:    
  Fly    52 SVTLRIVPLCIY----AFTYAEWISNRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVTKLV 112

  Fly    98 ----------LMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILAVFIYQWKA 152
                      .:|::|      |.....|:::        ||...::......|:..:.|.    
  Fly   113 NQYLHIFRLGTLDIRR------RSQFGGGREL--------FLLILSVCCQIHEYVFILVIA---- 159

  Fly   153 QNWSNLC--NGLLVNISLTILFV--NTFFYFTSLWHIARG--YDFVNQQLNEIVACQSMDLERKS 211
               |.||  ..::..:|.|.:|:  |:...|..:||::.|  |..:|..|......|:..| ||.
  Fly   160 ---SRLCGFQHIIWWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNLRFESGFQTAFL-RKQ 220

  Fly   212 KELR--GLWALHRNLSYTARRINKHYGPQMLAMRFDYFIFSIINACIGTIYSTTDQEPSLEKIFG 274
            :.:|  ...||.:.:|.....:.            |.|...:..:.:.|:...            
  Fly   221 QRIRVQKSMALFKEISSVVTSLQ------------DIFNVHLFLSALLTLLQV------------ 261

  Fly   275 SLIYWVRSFDFFLNDYICDL-VSEYQMQPKFFAPESSMSNELSSYLIYESSTR--------LDLL 330
             |:.|.:        .|.|| .|::::..  |:.::.:...|....|.|::.:        ||:.
  Fly   262 -LVVWYK--------MIIDLGFSDFRIWS--FSLKNLIQTLLPVLAIQEAANQFKQTRERALDIF 315

  Fly   331 VCGLYRVNKRKWLQMVGSIVVHSSMLFQFHLVMRG 365
            :.|    ..:.|::.|...|.|.: |.:|.:.:.|
  Fly   316 LVG----KSKHWMKSVEIFVTHLN-LSEFRVNLLG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 62/356 (17%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 63/360 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.