DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59b and Gr98b

DIOPT Version :9

Sequence 1:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:420 Identity:74/420 - (17%)
Similarity:149/420 - (35%) Gaps:134/420 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YWMIKLYFRYSLAIGITSQQFSNRKFFSTLFSRTYALIANIVTLIM------LPIVMWQVQLVFQ 61
            ::::..|..|:.||            .:|:|..:|..|..|...::      ...||..:|    
  Fly    41 WYLMTGYVFYATAI------------LATVFIVSYFNIIAIDEEVLEYNVSDFTRVMGNIQ---- 89

  Fly    62 QKKTFPKLILITNNVREAVSFLVILYTVLSRGFRDTAFKEMQPLLLTLFREEKRCGFKGIGGVRR 126
              |:...::.|.|::.     ::|.|..|...::|.|..||.      ..|..:|    .||.|:
  Fly    90 --KSLYSIMAIANHLN-----MLINYRRLGGIYKDIADLEMD------MDEASQC----FGGQRQ 137

  Fly   127 --SLR----------ILLFV------------KFFTLSWLCVTDVLFLLYSTDAL--------IW 159
              |.|          ::|.|            .|.:.....:|:.:.::....:|        |:
  Fly   138 RFSFRFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYCVFVLIIY 202

  Fly   160 VNVLRF----------FFKCNTNNILEMVPMGYFLALWHIARGFDCVNRRLDQIVKSKSTRKHRE 214
            ..|||.          |..|...::|:.:                ||..:.:|::          
  Fly   203 ELVLRLRRTLSQLQEEFQDCEQQDMLQAL----------------CVALKRNQLL---------- 241

  Fly   215 LQHLWLLHACLTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAV--FTFDLSTPF-FWVVYGS 276
            |..:|.|..       ::...:.|.||.....|.:..:....|..:  |.:|....: .::|..:
  Fly   242 LGRIWRLEG-------DVGSYFTPTMLLLFLYNGLTILHMVNWAYINKFLYDSCCQYERFLVCST 299

  Fly   277 VQYHV--------RCLDYYLIDNMCDVAVEYH---DSAKHSWSEVRWTKEISSYVIYANSTKLQL 330
            :..::        ||::.|    .|...:.:.   .||..:::.:  |:.:..|.:.....||:.
  Fly   300 LLVNLLLPCLLSQRCINAY----NCFPRILHKIRCTSADPNFAML--TRGLREYSLQMEHLKLRF 358

  Fly   331 WSCGLFQANRSMWFAMISSVLYYILVLLQF 360
            ...|||..|...:..::.::..||::|:||
  Fly   359 TCGGLFDINLKYFGGLLVTIFGYIIILIQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 74/417 (18%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 74/420 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.