DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr64c and LOC3290784

DIOPT Version :10

Sequence 1:NP_523913.2 Gene:Gr64c / 117479 FlyBaseID:FBgn0045477 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_061502077.1 Gene:LOC3290784 / 3290784 VectorBaseID:AGAMI1_003225 Length:170 Species:Anopheles gambiae


Alignment Length:70 Identity:17/70 - (24%)
Similarity:31/70 - (44%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VLVIAQFFGVLPVAGVWPSCRPERVRFRWISLSLLAALILFVFSIVDCALSSKVVFDHGLKIYTI 84
            ||::.|...:|||..:: |......||:..|...:.:|:....:.:.|.|..:.....||.:...
Mosquito    96 VLLLGQCITLLPVVNIF-SANYRTARFKLRSFRCIYSLVYLALTGIYCTLFIRWYIRKGLNLAYF 159

  Fly    85 GSLSF 89
            |:..|
Mosquito   160 GASEF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr64cNP_523913.2 Trehalose_recp 1..407 CDD:336318 17/70 (24%)
LOC3290784XP_061502077.1 None

Return to query results.
Submit another query.