DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr64f and Gr64b

DIOPT Version :9

Sequence 1:NP_728924.2 Gene:Gr64f / 117477 FlyBaseID:FBgn0052255 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_728921.1 Gene:Gr64b / 117480 FlyBaseID:FBgn0045478 Length:406 Species:Drosophila melanogaster


Alignment Length:392 Identity:117/392 - (29%)
Similarity:203/392 - (51%) Gaps:26/392 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SFHQAVGRVLLVAEFFAMMPVKGVTGKHPSDLSFSWRNIRTCFSLLFIASSLANFGLSLFKVLNN 140
            :||:||..||.:::.:.::||..|.....:|:.|.|.:.|..:|||....:|:.||..:..|:..
  Fly     6 TFHRAVSNVLFISQIYGLLPVSNVRALDVADIRFRWCSPRILYSLLIGILNLSEFGAVINYVIKV 70

  Fly   141 PISFNSIKPIIFRGSVLLVLIVAL-------NLARQWPQLMMYWHTVEK---DLPQYKTQLTKWK 195
            .|:|::       .|.|.:.||.|       .||.|||::|..||.||:   .:| |:. ..:::
  Fly    71 TINFHT-------SSTLSLYIVCLLEHLFFWRLAIQWPRIMRTWHGVEQLFLRVP-YRF-YGEYR 126

  Fly   196 MGHTISMVMLLGMMLSFAEHILSMVSAINYASF----CNRTADPIQNYFLRTNDEIFFVTSYSTT 256
            :...|.:|..:.|..:..||.|.:.::.:.::.    |.......::.:......::.:..|...
  Fly   127 IKRRIYIVFTIVMSSALVEHCLLLGNSFHLSNMERTQCKINVTYFESIYKWERPHLYMILPYHFW 191

  Fly   257 LALWGKFQNVFSTFIWNYMDLFVMIVSIGLASKFRQLNDDLRNFKGMNMAPSYWSERRIQYRNIC 321
            :....::.|....:..::.|.|:|.:.||||::|.||...:.......|...:|:|.|..|..:.
  Fly   192 MLPILEWVNQTIAYPRSFTDCFIMCIGIGLAARFHQLYRRIAAVHRKVMPAVFWTEVREHYLALK 256

  Fly   322 ILCDKMDDAISLITMVSFSNNLYFICVQLLRSLNTMPSVAHAVY--FYFSLIFLIGRTLAVSLYS 384
            .|...:|.||:.:.:::|.||:.|||.||..|...: .|...|.  |::||.|.:.|||.....:
  Fly   257 RLVHLLDAAIAPLVLLAFGNNMSFICFQLFNSFKNI-GVDFLVMLAFWYSLGFAVVRTLLTIFVA 320

  Fly   385 SSVHDESRLTLRYLRCVPKESWCPEVKRFTEEVISDEVALTGMKFFHLTRKLVLSVAGTIVTYEL 449
            ||::|..|..:..||.||..:|..||:||:|::.:|..||:|..||:|||.|||::..||:||||
  Fly   321 SSINDYERKIVTALRDVPSRAWSIEVQRFSEQLGNDTTALSGSGFFYLTRSLVLAMGTTIITYEL 385

  Fly   450 VL 451
            ::
  Fly   386 MI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr64fNP_728924.2 Trehalose_recp 56..462 CDD:253587 117/392 (30%)
Gr64bNP_728921.1 Trehalose_recp 3..400 CDD:253587 117/392 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469297
Domainoid 1 1.000 57 1.000 Domainoid score I7218
eggNOG 1 0.900 - - E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21421
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.