DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr93a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:446 Identity:88/446 - (19%)
Similarity:162/446 - (36%) Gaps:109/446 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LYSLTRVFGLMATANWSPRG---IKRVRQS-----LYLRIHGCVMLIFVGCFSPFAFWCIFQRMA 96
            ||...|  ||:..::...|.   :|..:|.     |::.....|::|:.|.:.......|.:|:.
  Fly    24 LYRCAR--GLLVLSSSLDRDKLQLKATKQGSRNRFLHILWRCIVVMIYAGLWPMLTSAVIGKRLE 86

  Fly    97 FLRQNRILLMIGFNRYVLLLVCAFMTLWIHCFKQAEIIGCLNRLLKCRRRLRRLMHTRKLKDSMD 161
            ....  :|.:.......:|.|.:|:   |....:.:....|||.|...:|:              
  Fly    87 SYAD--VLALAQSMSVSILAVISFV---IQARGENQFREVLNRYLALYQRI-------------- 132

  Fly   162 CLATKGHLLEVVVLLSSYLLSMAQPIQILKDDPEVRRNFMYACSLV-----------FVSVCQAI 215
            ||.|:...|.....:..:||.:                |...|...           |..:.| :
  Fly   133 CLTTRLRHLFPTKFVVFFLLKL----------------FFTLCGCFHEIIPLFENSHFDDISQ-M 180

  Fly   216 LQLSLGMY----TMAIL---FLGHLV-----RH-SNLLLAKILADAEHIFESSQKAGFWPNRQEL 267
            :....|:|    |:.:|   |||.||     .| :|.::| :|...|.|....::     .|...
  Fly   181 VGTGFGIYMWLGTLCVLDACFLGFLVSGILYEHMANNIIA-MLKRMEPIESQDER-----YRMTK 239

  Fly   268 YKGQQKW--LALELWRLLHVHHQLLKLHRSICSLCAVQAV--CFLGFVPLECTIHLFFTYFMKYS 328
            |:..|..  .|.||.....::.:|..:..|...:...|.:  .:|.|:.:...::.:..:|:...
  Fly   240 YRRMQLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLMLYQYILHFLNDD 304

  Fly   329 KFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCTREIIKGGGLAFPSRITVKQL 393
            :.:           :.:|........||:|:::...|:.|:....:::        |..|....:
  Fly   305 EVV-----------FVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKL--------PLDIVCSDM 350

  Fly   394 -----RHTMHFYG-LYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLMILIQF 443
                 :....|.| |..:.:|    :...|.|.|||..:..|:.||:.||.|||||
  Fly   351 DERWDKSVETFLGQLQTQRLE----IKVLGFFHLNNEFILLILSAIISYLFILIQF 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 88/446 (20%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 82/422 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.