DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr68a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:334 Identity:68/334 - (20%)
Similarity:124/334 - (37%) Gaps:95/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LEVVVLLSSYLLSMAQPIQ-----------ILKDDPEVRRNFM---YAC---SLVFVSVCQAILQ 217
            :|.::.:.||.:.:...:|           |.|.|..:..|..   |:|   :::..|....:|.
  Fly    83 IETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLA 147

  Fly   218 LS---------LGMYTMAILFLGHLVRHSNLLLAKILA--DAEHIFESSQKAGFWPNRQELYKGQ 271
            ::         :|.....||.|.:.::   ||.:.:||  ....:...:|:.||...:.:.:..|
  Fly   148 VAFYYIHYRSGIGAKRQIILLLIYFLQ---LLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQ 209

  Fly   272 -----QKWLALELWRLLHVHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFFTYFMKYSKFI 331
                 :.|  .||..|:.|..:...:..:|..:..|..:.:.||        .|:|...:     
  Fly   210 DCGHMENW--RELSNLIEVLCKFRYITENINCVAGVSLLFYFGF--------SFYTVTNQ----- 259

  Fly   332 LRKYGRSFPLNYFAIAFL--------------VGLF-------TNLLLVILPT---YYSERRFNC 372
                      :|.|.|.|              :||.       |..::||...   ..||  .|.
  Fly   260 ----------SYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASE--VNG 312

  Fly   373 TREIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYL 437
            |.:|:        :||..|..:..........|:::.....:|.|.|.::|:.||.|..|:..||
  Fly   313 TAQIL--------ARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYL 369

  Fly   438 MILIQFDKV 446
            :|||||.::
  Fly   370 VILIQFKQL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 67/330 (20%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 68/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.