DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr59e

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:329 Identity:64/329 - (19%)
Similarity:116/329 - (35%) Gaps:87/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RVFGLMATANWSPRGIKRVRQSLYLRIHGCVMLIFVGCFSPFAFWCIFQRMAFLRQNRILLMIGF 109
            |...||||.               |..||..:|:.|..:. |.||..:...:......:::.:| 
  Fly   120 RTLHLMATT---------------LVFHGLCVLVDVVNYD-FEFWTTWSSNSVYNLPGLMMSLG- 167

  Fly   110 NRYVLLLVCAFMTLWIHCFKQAEIIGCLNRLLKCRRRLRRLMHTRKLKDSMDCLATKGHLLEVVV 174
               ||........||:          .::::..|.:.|:.|....:....:|........:.|..
  Fly   168 ---VLQYAQPVHFLWL----------VMDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDA 219

  Fly   175 LLSSYLL--SMAQPIQILKDDPEVRRNFMYACSLVFV-SVCQAILQLSLGMYTMAILFLGHLVRH 236
            ...|.|:  .|.....:::   :|...|:....|..| ::..:::.:.:.:|.:...|...|...
  Fly   220 GGGSALMIEEMRYTCNLIE---QVHSQFLLRFGLYLVLNLLNSLVSICVELYLIFNFFETPLWEE 281

  Fly   237 SNLLLAKILADAEHIFESSQKAGFWPNRQELYKGQQKWLAL---ELWRLLHVHHQLLKLHRSICS 298
            |.||:.::|                            |||:   .:|.:|.|:.|:|:...::|.
  Fly   282 SVLLVYRLL----------------------------WLAMHGGRIWFILSVNEQILEQKCNLCQ 318

  Fly   299 LCAVQAVCFLGFVPLECTIHLFFTYFMKYSKFILRKYGRSF--PLNYFAIAFL----VGLFTNLL 357
            |.....||   ...|:.||:.|           |.:..||.  ||....|..|    :|.|..:|
  Fly   319 LLNELEVC---SSRLQRTINRF-----------LLQLQRSIDQPLEACGIVTLDTRSLGGFIGVL 369

  Fly   358 LVIL 361
            :.|:
  Fly   370 MAIV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 64/329 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 64/329 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.