DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr57a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:474 Identity:84/474 - (17%)
Similarity:154/474 - (32%) Gaps:167/474 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LPGMSALGILYSLTRVFGLMATANWSPRGIKRVRQSLYLRIHGCVMLIFVGCFSPFAFWCIFQRM 95
            |.|.:..||..|..|:       :|:.|                   |:....:..||.|:|..:
  Fly    26 LMGCNGFGIRRSTFRI-------SWASR-------------------IYSMSVAIAAFCCLFGSL 64

  Fly    96 AFL------------RQNRILLMIGFNRYVLLLVCAFMTLWIHCFKQAEIIGCLNRLLKCRRRL- 147
            :.|            ..|.:|.:......:..||.....:.:..|.:.. :|...||.....|| 
  Fly    65 SVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRH-LGIYQRLAALDARLM 128

  Fly   148 ----RRLMHTRKLKDSMDCLATKGHLLEVVVLLSSYLLSMAQPIQILKDDPEVRRNFMYACSLVF 208
                ..|.:.:.|:.::..|.         ::.:.||:                           
  Fly   129 SDFGANLNYRKMLRKNIAVLG---------IVTTIYLM--------------------------- 157

  Fly   209 VSVCQAILQLSLGMYTMAILFL---------GHLVRHSNLLLAKILADAEHIFESSQKAGFWPNR 264
             ::..|.:|::.|...:.:||.         .|...:.::.||::|.....:.            
  Fly   158 -AINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLL------------ 209

  Fly   265 QELYKGQQKWLALELWRLLHVHHQLLK----------LHRSICSLCAVQAVCFLGFVPLECTIHL 319
            |:|.  |.::|.   ||...:|.|.|:          ||..|..:..|.|:.....:..:..:..
  Fly   210 QQLL--QPEFLN---WRFPQLHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMST 269

  Fly   320 FFTYFMKYSKFILRKYGRSF---------------PLNYFAIAFLVGLFTNLLLVILPTY----- 364
            ...|.:         :|:|.               .|.|.|:..:..|:.   |:|.|.|     
  Fly   270 SELYIL---------FGQSVGIGQQNEEENGSCYRMLGYLALVMIPPLYK---LLIAPFYCDRTI 322

  Fly   365 YSERRFNCTREIIKGGGLAFPSRITVKQLRHTMHFYGLYLK-----NVEHVFAVSACGLFKLNNA 424
            |..||  |.|.:.|.... ||.:.:::.|..::..:.:..|     .::.|.:....|||     
  Fly   323 YEARR--CLRLVEKLDDW-FPQKSSLRPLVESLMSWRIQAKIQFTSGLDVVLSRKVIGLF----- 379

  Fly   425 ILFCIVGAILEYLMILIQF 443
                 ...::.||:|||||
  Fly   380 -----TSILVNYLLILIQF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 82/468 (18%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 82/468 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.