DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr77a and Gr43a

DIOPT Version :9

Sequence 1:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:189 Identity:47/189 - (24%)
Similarity:79/189 - (41%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KAGFWPNRQELYKGQQKWLALELWRLLHVHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFF 321
            |.|::|.:.   ||      |.|..|...|..|.|....:.:...:..:    |:.:.|.:||..
  Fly   284 KLGYFPAKN---KG------LLLKSLADSHESLGKCVHLLSNSFGIAVL----FILVSCLLHLVA 335

  Fly   322 TYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCTREIIKGGGLAFPS 386
            |.:..:.:.:.::......:....|.|   .|..||:|:.|.:.:.|....|.:|:    .....
  Fly   336 TAYFLFLELLSKRDNGYLWVQMLWICF---HFLRLLMVVEPCHLAARESRKTIQIV----CEIER 393

  Fly   387 RITVKQLRHTMHFYGLYLKNVEHVFAVSACGLFKLNNAILFCIVGAILEYLMILIQFDK 445
            ::....|...:..:...|..|:..|  |||||.::|..||.....||..||:|||||.:
  Fly   394 KVHEPILAEAVKKFWQQLLVVDADF--SACGLCRVNRTILTSFASAIATYLVILIQFQR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 46/186 (25%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 46/186 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.